Protein Info for DZA65_RS01395 in Dickeya dianthicola ME23

Annotation: protein-methionine-sulfoxide reductase catalytic subunit MsrP

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 333 signal peptide" amino acids 1 to 44 (44 residues), see Phobius details PF00174: Oxidored_molyb" amino acids 107 to 266 (160 residues), 111.6 bits, see alignment E=1.6e-36

Best Hits

Swiss-Prot: 83% identical to MSRP_PECAS: Protein-methionine-sulfoxide reductase catalytic subunit MsrP (msrP) from Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)

KEGG orthology group: K07147, (no description) (inferred from 97% identity to ddd:Dda3937_04444)

MetaCyc: 72% identical to protein-L-methionine sulfoxide reductase catalytic subunit MsrP (Escherichia coli K-12 substr. MG1655)
1.8.5.M7 [EC: 1.8.5.M7]; 1.8.5.M7 [EC: 1.8.5.M7]

Predicted SEED Role

"Putative sulfite oxidase subunit YedY"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.8.5.M7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XT05 at UniProt or InterPro

Protein Sequence (333 amino acids)

>DZA65_RS01395 protein-methionine-sulfoxide reductase catalytic subunit MsrP (Dickeya dianthicola ME23)
MSRHRKLTDADVTPESLFHQRRTVLKALGLTAATLSLPSGARADLLNWFQGKPAPVAPPG
KPLTFSQPPQWRPTLALTPEDKVTGYNNFYEFGLDKADAAANAGGLKTEGWKVRIDGDVA
KPITLDIDDIRRRFALEERIYRFRCVEAWSMVIPWVGFELSQLIKLAEPTSDARYVAFQT
LHDPEQMPGQKDSFVGGGLDYPYVEGLRLDEAMHPLTLLAVGVYGKTLPPQNGAPIRLVT
PWKYGFKNIKSIVHIRLTRQPPPSTWNLSAPNEYGFYANVNPNVDHPRWSQASERAIGAG
GLLNVQRQPTLMFNGYADQVASLYQGLDLRANF