Protein Info for DZA65_RS01310 in Dickeya dianthicola ME23

Annotation: amino acid ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 256 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF00497: SBP_bac_3" amino acids 35 to 252 (218 residues), 152.2 bits, see alignment E=6.6e-49 PF12974: Phosphonate-bd" amino acids 118 to 238 (121 residues), 29 bits, see alignment E=6.8e-11

Best Hits

Swiss-Prot: 46% identical to Y1080_HAEIN: Probable amino-acid ABC transporter-binding protein HI_1080 (HI_1080) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K02030, polar amino acid transport system substrate-binding protein (inferred from 96% identity to ddd:Dda3937_01581)

Predicted SEED Role

"ABC-type amino acid transport/signal transduction systems, periplasmic component/domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CCB9 at UniProt or InterPro

Protein Sequence (256 amino acids)

>DZA65_RS01310 amino acid ABC transporter substrate-binding protein (Dickeya dianthicola ME23)
MKTSRLALLTGALLVTSALAQSQDDLSAIKAAGVIKFGTEGTYAPYTYHDASGKLVGFDV
DVGRAVAEKLGVKAEFVEGRWDGLIAGVDAKRYDAVINQVGVTKERQVKYDFTQPYIDAK
SVLIVHSDNTSIKSFNDLKGHKSAQSLTSNYSKLATSYGAEIVPTDGFNQSLELVLSGRA
EATLNDNLSFLDFKKHKPDAKVKVVATAESGDPSAILVRKNQPQLVDALNKALDQIKADG
TYKTISVRYFGQDVSK