Protein Info for DZA65_RS01305 in Dickeya dianthicola ME23

Annotation: amino acid ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 221 transmembrane" amino acids 20 to 46 (27 residues), see Phobius details amino acids 58 to 78 (21 residues), see Phobius details amino acids 89 to 108 (20 residues), see Phobius details amino acids 126 to 148 (23 residues), see Phobius details amino acids 150 to 150 (1 residues), see Phobius details amino acids 187 to 207 (21 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 14 to 110 (97 residues), 106.8 bits, see alignment E=3.5e-35 PF00528: BPD_transp_1" amino acids 34 to 213 (180 residues), 82.8 bits, see alignment E=1.4e-27

Best Hits

Swiss-Prot: 52% identical to TCYB_BACSU: L-cystine transport system permease protein TcyB (tcyB) from Bacillus subtilis (strain 168)

KEGG orthology group: K02029, polar amino acid transport system permease protein (inferred from 96% identity to ddc:Dd586_0245)

MetaCyc: 49% identical to cystine ABC transporter membrane subunit (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-290 [EC: 7.4.2.12]; 7.4.2.12 [EC: 7.4.2.12]; 7.4.2.- [EC: 7.4.2.12]; 7.4.2.- [EC: 7.4.2.12]; 7.4.2.- [EC: 7.4.2.12]; 7.4.2.- [EC: 7.4.2.12]

Predicted SEED Role

"Cystine ABC transporter, permease protein"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XU77 at UniProt or InterPro

Protein Sequence (221 amino acids)

>DZA65_RS01305 amino acid ABC transporter permease (Dickeya dianthicola ME23)
MPSWLQLMADSFWSLLSAGLTFTVPLAILSFILGLMVGVLVALLRLYGPKPLKRICDFYV
WVIRGTPLLVQLFLIFYGLPSASITLDAFPAALIGFSLNVGAYSSEIVRGAILSVPRGQW
NAAYSLGMSGAQAIRWVIVPQSVFVSLPPLANTFISLVKDTSLAAVITVPEMFLAAQRIV
SVTYEPLILYIEAALIYLLFSTVLSKLQTRLEKYYQRHTVH