Protein Info for DZA65_RS01090 in Dickeya dianthicola ME23

Annotation: bifunctional biotin--[acetyl-CoA-carboxylase] ligase/biotin operon repressor BirA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 319 transmembrane" amino acids 123 to 138 (16 residues), see Phobius details amino acids 145 to 164 (20 residues), see Phobius details TIGR00122: biotin operon repressor" amino acids 6 to 75 (70 residues), 86.6 bits, see alignment E=8e-29 PF08279: HTH_11" amino acids 9 to 58 (50 residues), 36.9 bits, see alignment 4.2e-13 TIGR00121: biotin--[acetyl-CoA-carboxylase] ligase" amino acids 81 to 317 (237 residues), 246 bits, see alignment E=3.9e-77 PF03099: BPL_LplA_LipB" amino acids 84 to 208 (125 residues), 97.8 bits, see alignment E=7.2e-32 PF02237: BPL_C" amino acids 273 to 317 (45 residues), 44.8 bits, see alignment 1.4e-15

Best Hits

Swiss-Prot: 74% identical to BIRA_SALTY: Bifunctional ligase/repressor BirA (birA) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K03524, BirA family transcriptional regulator, biotin operon repressor / biotin-[acetyl-CoA-carboxylase] ligase [EC: 6.3.4.15] (inferred from 95% identity to ddd:Dda3937_04217)

MetaCyc: 72% identical to DNA-binding transcriptional repressor/biotin-[acetyl-CoA-carboxylase] ligase BirA (Escherichia coli K-12 substr. MG1655)
Biotin--[acetyl-CoA-carboxylase] ligase. [EC: 6.3.4.15]

Predicted SEED Role

"Biotin--protein ligase (EC 6.3.4.9, EC 6.3.4.10, EC 6.3.4.11, EC 6.3.4.15) / Biotin operon repressor" in subsystem Biotin biosynthesis

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.4.15

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CA72 at UniProt or InterPro

Protein Sequence (319 amino acids)

>DZA65_RS01090 bifunctional biotin--[acetyl-CoA-carboxylase] ligase/biotin operon repressor BirA (Dickeya dianthicola ME23)
MKDYTVPLKLISILSDGEFYSGEYLGELMGMSRAAINKHIQTIREWGLDVFTVTGKGYAL
SAPIQLLDAEKIRSQIESGNIAVLPVIDSTNQYLLDRLDSVSSGDACIAEYQHAGRGRRG
RKWFSPFGSNLYLSLYWRLEQGPAAAVGVSLVIGIIMAEVLHHLGAEGVRVKWPNDLYLN
DKKLAGILVELNGRTGDAAHLVIGAGINLRMNSSGSDVINQGWINLQDAGIDMDRNMLAV
RLITELRTALAIYEQQGLASFISRWNGLDNFYNRAVKLIVGNREIKGIDKGIDSQGALLL
EQDGEIQSYIGGEISLRGW