Protein Info for DZA65_RS01045 in Dickeya dianthicola ME23

Annotation: IMPACT family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 204 TIGR00257: uncharacterized protein, YigZ family" amino acids 1 to 200 (200 residues), 232.7 bits, see alignment E=1.5e-73 PF01205: Impact_N" amino acids 18 to 125 (108 residues), 116.1 bits, see alignment E=7.4e-38 PF09186: DUF1949" amino acids 141 to 195 (55 residues), 42.8 bits, see alignment E=3.9e-15

Best Hits

Swiss-Prot: 59% identical to YIGZ_ECOLI: IMPACT family member YigZ (yigZ) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 95% identity to ddd:Dda3937_02079)

Predicted SEED Role

"FIG000605: protein co-occurring with transport systems (COG1739)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CJN6 at UniProt or InterPro

Protein Sequence (204 amino acids)

>DZA65_RS01045 IMPACT family protein (Dickeya dianthicola ME23)
MQSYPVPAASVSVHEEIKKSRFITLLGPASGVGAARSVIQQIREQHPAAAHHCWAYVAGA
PDDSQQLGFSDDGEPSGTAGKPMLAQLMGSGIGEVAAVVVRYYGGVRLGTGGLVKAYGGG
VQQALKQLPLQQKVMQRLYRLQCDYALLPQVETVVLALEGQIVSTEYAGEVSLQLAFPVT
AVEDASRRLRDISRGALHLQPISQ