Protein Info for DZA65_RS00860 in Dickeya dianthicola ME23

Annotation: phospholipid:lipid A palmitoyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF07017: PagP" amino acids 51 to 197 (147 residues), 225.3 bits, see alignment E=9.7e-72

Best Hits

Swiss-Prot: 92% identical to PAGP_DICD3: Lipid A palmitoyltransferase PagP (pagP) from Dickeya dadantii (strain 3937)

KEGG orthology group: K12973, palmitoyl transferase [EC: 2.3.1.-] (inferred from 93% identity to ddd:Dda3937_02050)

MetaCyc: 66% identical to lipid A palmitoyltransferase monomer (Salmonella enterica enterica serovar Typhimurium str. LT2)
RXN-16274 [EC: 2.3.1.251]; 2.3.1.251 [EC: 2.3.1.251]; 2.3.1.251 [EC: 2.3.1.251]

Predicted SEED Role

"Lipid A acylation protein PagP, palmitoyltransferase" in subsystem Lipid A modifications

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.- or 2.3.1.251

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XWL4 at UniProt or InterPro

Protein Sequence (200 amino acids)

>DZA65_RS00860 phospholipid:lipid A palmitoyltransferase (Dickeya dianthicola ME23)
MRLSAASHTCLFALSSLLFTPVFAATSGDNTASDAVESGSEPGVWRRAGDNLSETWHHWQ
SQELYVPVKTWHNRWTYDKAKTDRYNERPWGAGYGVSRLDRDGDWHSLYLMAFKDSFNKW
EPIGGYGYEKRWRPLENQDVQLGLGFTAGVTMRDNWKYIPIPVLLPMASVSYQRLSFQAT
YIPGTYNNGNVLFAWLRWQF