Protein Info for DZA65_RS00820 in Dickeya dianthicola ME23

Annotation: ADP-heptose--LPS heptosyltransferase RfaF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 TIGR02195: lipopolysaccharide heptosyltransferase II" amino acids 2 to 341 (340 residues), 536.3 bits, see alignment E=1.5e-165 PF01075: Glyco_transf_9" amino acids 69 to 323 (255 residues), 256.2 bits, see alignment E=1.4e-80

Best Hits

Swiss-Prot: 74% identical to RFAF_ECOLI: ADP-heptose--LPS heptosyltransferase 2 (rfaF) from Escherichia coli (strain K12)

KEGG orthology group: K02843, heptosyltransferase II [EC: 2.4.-.-] (inferred from 96% identity to ddd:Dda3937_02040)

MetaCyc: 74% identical to ADP-heptose--LPS heptosyltransferase 2 (Escherichia coli K-12 substr. MG1655)
RXN0-5061 [EC: 2.4.99.24]

Predicted SEED Role

"ADP-heptose--lipooligosaccharide heptosyltransferase II (EC 2.4.1.-)" in subsystem LOS core oligosaccharide biosynthesis (EC 2.4.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.4.-.-, 2.4.1.-

Use Curated BLAST to search for 2.4.-.- or 2.4.1.- or 2.4.99.24

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XS51 at UniProt or InterPro

Protein Sequence (350 amino acids)

>DZA65_RS00820 ADP-heptose--LPS heptosyltransferase RfaF (Dickeya dianthicola ME23)
MKILVIGPSWVGDMMMSHSLYRTLKAEHPDAIIDVMAPTWCRPLLARMPEVHQALSMPLG
HGMLALGERRRLGVSLREQRYDCAYVLPNSFKSALVPFFADIAYRTGWRGEMRYGLLNDL
RVLDKAAFPLMVQRYVALAYDRARIHTAADLPQPLLWPQLAVNDAEIADVAAAFNLTDAR
PLIGFCPGAEFGPAKRWPHYHYGSLAQTLIEQGYQVVLFGSNNDRQAGEDIRQTLSADAR
EHCINLAGQTALDQAVVLIAACQAIVSNDSGLMHVAAALNRPLVALYGPSSPDFTPPLSH
QAEVIRLITGYHRVRKGDAERGYHQSLIDIQPQQVLDALSRYLPAKGEPA