Protein Info for DZA65_RS00810 in Dickeya dianthicola ME23

Annotation: putative lipopolysaccharide heptosyltransferase III

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 361 TIGR02201: putative lipopolysaccharide heptosyltransferase III" amino acids 11 to 354 (344 residues), 305.7 bits, see alignment E=2e-95 PF01075: Glyco_transf_9" amino acids 83 to 331 (249 residues), 149.2 bits, see alignment E=6.9e-48

Best Hits

KEGG orthology group: K02849, heptosyltransferase III [EC: 2.4.-.-] (inferred from 96% identity to ddd:Dda3937_02038)

Predicted SEED Role

"Lipopolysaccharide heptosyltransferase III (EC 2.4.1.-)" in subsystem LOS core oligosaccharide biosynthesis (EC 2.4.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.4.-.-, 2.4.1.-

Use Curated BLAST to search for 2.4.-.- or 2.4.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XWK1 at UniProt or InterPro

Protein Sequence (361 amino acids)

>DZA65_RS00810 putative lipopolysaccharide heptosyltransferase III (Dickeya dianthicola ME23)
MTSPHKVELRRILITKFRHHGDVLLTSPLFSILRQRYPDAQIDALVFTDTAEMLSLHPAI
DHLHTVDKKWKKLGMFGHLAQEWALLKTLRAQRYDAIIHLTESMRGLWIARLAGIPLGVT
FRNSARDKLSFWKKTFQYRVPRISRRHTVESHLDTLRVLGIQPEPQARRLHLVAGEDADR
AVDQKLRAQQWQGQPFIVVHPTSRWLFKCWKSSAMAETINTLCERGHTIVLSASPAENEM
AMIADIKSRLTHPVLDLAGQLTLKQLASLIGNAQLLLGVDSVPMHIASAMQTPVVALFGP
SGEDEWAPWMTVNRVIVSDRHPCRPCGKDGCGGSKVSDCLQQISVQQVLLAVDSALLEAQ
G