Protein Info for DZA65_RS00805 in Dickeya dianthicola ME23

Annotation: glycosyltransferase family 4 protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 372 PF13439: Glyco_transf_4" amino acids 14 to 178 (165 residues), 77.7 bits, see alignment E=1.7e-25 PF00534: Glycos_transf_1" amino acids 190 to 338 (149 residues), 91.9 bits, see alignment E=5.3e-30 PF13692: Glyco_trans_1_4" amino acids 203 to 336 (134 residues), 90.1 bits, see alignment E=2.5e-29

Best Hits

KEGG orthology group: K02844, UDP-glucose:(heptosyl)LPS alpha-1,3-glucosyltransferase [EC: 2.4.1.-] (inferred from 95% identity to ddd:Dda3937_02037)

Predicted SEED Role

"UDP-glucose:(heptosyl) LPS alpha1,3-glucosyltransferase WaaG (EC 2.4.1.-)" in subsystem LOS core oligosaccharide biosynthesis (EC 2.4.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.4.1.-

Use Curated BLAST to search for 2.4.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XVB7 at UniProt or InterPro

Protein Sequence (372 amino acids)

>DZA65_RS00805 glycosyltransferase family 4 protein (Dickeya dianthicola ME23)
MKLAIVRQKYRPDGGAERFVSRALDALSNHRSLDVSVITRSWDGAEQANRNVIICNPRIT
GRVQRESAFAQAAQQHFAAFDLVQSHERIPGCHVYRAGDGVHQSWLTQRARILNPLQRRL
LWWSGFHRYVMAQEQAMYQHPSLKAVICNSQMVADEIRRYFGVPADKIHLIYNGVNTDTF
TPGLRAAYRRDLREQLGVPPNAPVMLFVGSGFERKGLAGAIHAISGVPQHPHLMVVGKDK
HSRRYQRLARRFGVAERVHFVGMQPDTRPYYGAADMLLLPTLYDPFPNVVLEAMASGLGV
ITSQQCGGKEFIQLGVNGFVCDSLDYDGLRQSVRQACETGFDGFGEQARAKVERYDLRFL
SDNMLKLYAQLI