Protein Info for DZA65_RS00790 in Dickeya dianthicola ME23

Annotation: glycosyltransferase family 4 protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 374 PF13439: Glyco_transf_4" amino acids 17 to 173 (157 residues), 70.6 bits, see alignment E=4.3e-23 PF13579: Glyco_trans_4_4" amino acids 18 to 169 (152 residues), 39.5 bits, see alignment E=1.8e-13 PF00534: Glycos_transf_1" amino acids 189 to 346 (158 residues), 123.6 bits, see alignment E=1.6e-39 PF13692: Glyco_trans_1_4" amino acids 193 to 333 (141 residues), 123.7 bits, see alignment E=1.8e-39 PF13524: Glyco_trans_1_2" amino acids 279 to 355 (77 residues), 27.3 bits, see alignment E=8.6e-10

Best Hits

KEGG orthology group: None (inferred from 98% identity to ddd:Dda3937_02034)

Predicted SEED Role

"Glycosyltransferase (EC 2.4.1.-)" (EC 2.4.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.4.1.-

Use Curated BLAST to search for 2.4.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XS24 at UniProt or InterPro

Protein Sequence (374 amino acids)

>DZA65_RS00790 glycosyltransferase family 4 protein (Dickeya dianthicola ME23)
MLDTSLNILHTESSCGWGGQEIRILTESQGMMKRGHKVTILCCPHSNIYREAQARGIAVV
GLPIEKKRLSSLLALVGWLRQHGCAFDIINTHSSTDAWLVAVAGLMLGKRVPPMVRTRHV
STDINRSLTTRWLYMTATRHIATTGERLRQQLHRDNRYPLSRMTSVPTGIDLSFYRQAAR
QSARQTIGVPDRPTLGILATMRSWKGHAYLLEAWQTLAKDFPDWQLLMVGDGPQRQALEQ
QVVSMGLADRVIFLGNRDDVPDCLNSMDLFVLPSYGNEGVPQSIMQAMACGLPVVSTTVG
AIDEAVVNEQTGYLITPKNTALLEQTLRQLMGDDALRGQFGEAALKRASEQFGADIMLDK
MTTIFRNSLRSTRS