Protein Info for DZA65_RS00745 in Dickeya dianthicola ME23

Annotation: dUTP diphosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 152 TIGR00576: dUTP diphosphatase" amino acids 10 to 151 (142 residues), 161.5 bits, see alignment E=5.3e-52 PF00692: dUTPase" amino acids 17 to 150 (134 residues), 142.7 bits, see alignment E=5.5e-46 PF22769: DCD" amino acids 43 to 122 (80 residues), 40.1 bits, see alignment E=4.3e-14

Best Hits

Swiss-Prot: 91% identical to DUT_KLEP3: Deoxyuridine 5'-triphosphate nucleotidohydrolase (dut) from Klebsiella pneumoniae (strain 342)

KEGG orthology group: K01520, dUTP pyrophosphatase [EC: 3.6.1.23] (inferred from 97% identity to ddc:Dd586_0147)

MetaCyc: 85% identical to dUTP diphosphatase (Escherichia coli K-12 substr. MG1655)
dUTP diphosphatase. [EC: 3.6.1.23, 3.6.1.9]

Predicted SEED Role

"Deoxyuridine 5'-triphosphate nucleotidohydrolase (EC 3.6.1.23)" in subsystem Nudix proteins (nucleoside triphosphate hydrolases) (EC 3.6.1.23)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.1.23 or 3.6.1.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4D0V4 at UniProt or InterPro

Protein Sequence (152 amino acids)

>DZA65_RS00745 dUTP diphosphatase (Dickeya dianthicola ME23)
MMKKIDVKILDARIGQQFPLPTYATPGSAGLDLRACLDSAVELAAGATTLVPTGLAIHIA
DPSLAAVILPRSGLGHKHGVVLGNLVGLIDSDYQGQLMVSVWNRGSQSFIIEPGERIAQM
VFVPVVQAEFNLVNDFVDSERGEGGFGHSGRH