Protein Info for DZA65_RS00695 in Dickeya dianthicola ME23

Annotation: ABC transporter permease subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 306 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 99 to 122 (24 residues), see Phobius details amino acids 134 to 161 (28 residues), see Phobius details amino acids 173 to 191 (19 residues), see Phobius details amino acids 227 to 253 (27 residues), see Phobius details amino acids 273 to 299 (27 residues), see Phobius details PF19300: BPD_transp_1_N" amino acids 1 to 92 (92 residues), 56.7 bits, see alignment E=2.6e-19 PF00528: BPD_transp_1" amino acids 113 to 304 (192 residues), 139.4 bits, see alignment E=1.1e-44

Best Hits

Swiss-Prot: 54% identical to GSIC_ECOL6: Glutathione transport system permease protein GsiC (gsiC) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K13890, glutathione transport system permease protein (inferred from 98% identity to dze:Dd1591_3972)

MetaCyc: 53% identical to glutathione ABC transporter membrane subunit GsiC (Escherichia coli K-12 substr. MG1655)
RXN0-11 [EC: 7.4.2.10]

Predicted SEED Role

"Dipeptide transport system permease protein DppB (TC 3.A.1.5.2)" in subsystem ABC transporter dipeptide (TC 3.A.1.5.2) (TC 3.A.1.5.2)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4D523 at UniProt or InterPro

Protein Sequence (306 amino acids)

>DZA65_RS00695 ABC transporter permease subunit (Dickeya dianthicola ME23)
MFVYIVRRLLEMIPVLLVISLLVFGFIKLLPGDPARIYAGPDAPIEAVEAARERLGLNDP
LPQQYLNWLDGLVHGDLGITYRTQQPVLSVIQKSFMPTLWLALAGFAWSVLLGLLIGVFA
ALKRGKWQDWSLMSLAVGGISMPPFWLGLLLIQFVAMPFGVFSVSGYNKPADIILPALTL
GASVAAVMARFTRSAFLEVTQEDYVRTARAKGLRQRLIVWKHVMRNALIPVITMLGLQFG
FLLGGSIVVESVFNWPGLGWLLIESIKTQDQPVIQALVMLFVFEFILINLLVDLLYAVVN
PAIRLR