Protein Info for DZA65_RS00495 in Dickeya dianthicola ME23

Annotation: acyl--CoA ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 527 transmembrane" amino acids 65 to 85 (21 residues), see Phobius details amino acids 218 to 235 (18 residues), see Phobius details amino acids 250 to 271 (22 residues), see Phobius details PF00501: AMP-binding" amino acids 12 to 372 (361 residues), 263.1 bits, see alignment E=3.8e-82 PF13193: AMP-binding_C" amino acids 428 to 501 (74 residues), 63.5 bits, see alignment E=2.9e-21

Best Hits

KEGG orthology group: None (inferred from 95% identity to ddd:Dda3937_03214)

Predicted SEED Role

"Small Molecule Metabolism; Fatty acid biosynthesis"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XSM6 at UniProt or InterPro

Protein Sequence (527 amino acids)

>DZA65_RS00495 acyl--CoA ligase (Dickeya dianthicola ME23)
MTNITHLTAWLDRAAKEAANKTAIIDTDREVSWFMLRLQALQLADHLRENGVEKGDRVIV
CMPNSLTFVLSFWALQYLGAIFIPLNPDTKASKLSWLVDNAGCRLLIADHALKDEIGIAQ
AGEHWQQYNRHTCVCFSNDVAAMLAEEPYRISVERDRQETGIDLDLACIIYTSGSTGHPK
GVMLSRRNMITAASSVAGYLQLCGDDRIMSMIPMSFDYGLYQVIMSALAQCTLIVEPDFR
RPLLSLQRMVTLRATVLPIVPTMLRLIAPLASRYHFDAIRTVTNTAAALHAGDIDRLHTI
FPQARIYSMYGLTECHRCTYLPPEYLATHPLSVGIAIPNTELWVVDDNGQRHTRNATGEL
VIRGATIMCGYWRNEEKSAEKLRPGLLPGERVLYTGDICRLDEQGLLYFVGRRDEMLKNC
GEKVAPKEVEAVLNRHPQVAQAVVLGVPHPIYGDEIIACVVTRGDLNEKALSRWSKTQME
PHMVPHRFRLMSRLPLNHNGKINRSLLREQLTAGATAQVCPQHGLME