Protein Info for DZA65_RS00345 in Dickeya dianthicola ME23

Annotation: nickel/cobalt efflux protein RcnA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 297 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 54 to 79 (26 residues), see Phobius details amino acids 91 to 109 (19 residues), see Phobius details amino acids 198 to 219 (22 residues), see Phobius details amino acids 228 to 253 (26 residues), see Phobius details amino acids 274 to 293 (20 residues), see Phobius details PF03824: NicO" amino acids 15 to 293 (279 residues), 185.6 bits, see alignment E=1.3e-58 PF13386: DsbD_2" amino acids 190 to 265 (76 residues), 25 bits, see alignment E=1.6e-09

Best Hits

Swiss-Prot: 68% identical to RCNA_ECO57: Nickel/cobalt efflux system RcnA (rcnA) from Escherichia coli O157:H7

KEGG orthology group: None (inferred from 86% identity to ddd:Dda3937_00978)

Predicted SEED Role

"Nickel/cobalt efflux transporter RcnA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4C8C9 at UniProt or InterPro

Protein Sequence (297 amino acids)

>DZA65_RS00345 nickel/cobalt efflux protein RcnA (Dickeya dianthicola ME23)
MTDFSLLLQQGVANAWLFIPSAVLLGALHGLEPGHSKTMMAAFIVAIRGTVKQAVMLGVA
ATLSHTAVVWLIALGGMYLSRQFTADSAEPWLQFVSGIIILGTAVWMFWRTWRDERAWAQ
HQHSHDHHDHHHHHDHHHHHGHDEHADHRHDHNHAHHHAEHPHDHAQAHGEYQDAHERAH
ANEIRLRFANREATNGQILLFGLTGGLIPCPAAITVLLLCIQVKAFTLGAALVVCFSIGL
ALTLVAVGVGAALSVQHASRRWPGFATLARRAPYFSSLLIAVVGVYMLLHGWARLPL