Protein Info for DZA65_RS00330 in Dickeya dianthicola ME23

Annotation: DNA-binding transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 407 PF13407: Peripla_BP_4" amino acids 87 to 254 (168 residues), 36.5 bits, see alignment E=8.2e-13 PF13377: Peripla_BP_3" amino acids 113 to 278 (166 residues), 115.5 bits, see alignment E=5.6e-37 PF00165: HTH_AraC" amino acids 295 to 332 (38 residues), 30.6 bits, see alignment 5.7e-11 amino acids 349 to 385 (37 residues), 39 bits, see alignment 1.3e-13 PF12833: HTH_18" amino acids 310 to 387 (78 residues), 69.7 bits, see alignment E=4.4e-23

Best Hits

Swiss-Prot: 81% identical to XYLR_ECO57: Xylose operon regulatory protein (xylR) from Escherichia coli O157:H7

KEGG orthology group: K02529, LacI family transcriptional regulator (inferred from 98% identity to ddd:Dda3937_00981)

Predicted SEED Role

"Xylose activator XylR (AraC family)" in subsystem Xylose utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CDX9 at UniProt or InterPro

Protein Sequence (407 amino acids)

>DZA65_RS00330 DNA-binding transcriptional regulator (Dickeya dianthicola ME23)
MFEKRYRITLLFNANKVYDRQVVEGVGEYLQASQCDWDIFIEEDFRCRIDNIRDWLGDGV
IADFDDPAIIALLAGVRVPLVGVGGSYHSPQDYPPVHYIATDNYALVESAFLHLKNKGLN
RFAFYGLPASVGKGWAQEREHAFRQLVAAEQYQGVVYQGMETSPGNWQYAQNRLADWIQT
LPPQTGIIAVTDARARHLLQVCEHLNIAVPEKLCVIGIDNEELTRYLSRVALSSVAQGTR
QMGYRAAKLLHQLLLTPYALPLQRILVPPLRVVERSSTDYRSVHDPAVIQAMHFIRHHAC
KGIKVEQVLDAVGLSRSNLEKRFKDETGQTIHGMIHTEKLERARNLLVSTSLSINEISSM
CGYPSLPYFYSVFRKDYDLTPREYRERYGYRERYGEGGYGDSRYDNE