Protein Info for DZA65_RS00045 in Dickeya dianthicola ME23

Annotation: 23S rRNA (adenine(2030)-N(6))-methyltransferase RlmJ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 280 PF04378: RsmJ" amino acids 33 to 278 (246 residues), 386.9 bits, see alignment E=1.8e-120

Best Hits

Swiss-Prot: 79% identical to RLMJ_ECOLI: Ribosomal RNA large subunit methyltransferase J (rlmJ) from Escherichia coli (strain K12)

KEGG orthology group: K07115, (no description) (inferred from 95% identity to ddd:Dda3937_01052)

MetaCyc: 79% identical to 23S rRNA m6A2030 methyltransferase (Escherichia coli K-12 substr. MG1655)
RXN0-6998 [EC: 2.1.1.266]

Predicted SEED Role

"Protein involved in catabolism of external DNA"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.266

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XRS4 at UniProt or InterPro

Protein Sequence (280 amino acids)

>DZA65_RS00045 23S rRNA (adenine(2030)-N(6))-methyltransferase RlmJ (Dickeya dianthicola ME23)
MLSYRHSFHAGNHADVLKHTVQSLIITALKEKDKPLLYLDTHSGAGRYQLQSEHAERTGE
YLDGIGRIWQRDDIPAELEPYMQVVRSYNSGDKLRYYPGSPLIARQLLREQDNIHLTELH
PSDFPLLRQEFLRDDRARVVREDGYQQLKAQLPPPSRRGLILIDPPYELKTDYQAVVTGV
QEGYRRFATGVFALWYPVVLRQHIKRLLKELEGTGIRRILQIELAVLPDSARHGMTASGM
IVINPPWKLESQMKSVLPWLHHALVPTGTGHTRVEWVVPE