Protein Info for DDA3937_RS22560 in Dickeya dadantii 3937

Annotation: membrane protein insertion efficiency factor YidD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 85 PF01809: YidD" amino acids 10 to 75 (66 residues), 106.5 bits, see alignment E=2.4e-35 TIGR00278: putative membrane protein insertion efficiency factor" amino acids 12 to 83 (72 residues), 110.8 bits, see alignment E=1.1e-36

Best Hits

Swiss-Prot: 85% identical to YIDD_SODGM: Putative membrane protein insertion efficiency factor (SG2430) from Sodalis glossinidius (strain morsitans)

KEGG orthology group: K08998, hypothetical protein (inferred from 99% identity to dze:Dd1591_4265)

Predicted SEED Role

"Protein YidD"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SNF9 at UniProt or InterPro

Protein Sequence (85 amino acids)

>DDA3937_RS22560 membrane protein insertion efficiency factor YidD (Dickeya dadantii 3937)
MAPSLSFGSRLLIGLIRGYQRFISPLLGPHCRFQPSCSQYGIEAIRRFGMIKGSWLTLKR
VLKCHPLNPGGDDPVPPKPDNNREH