Protein Info for DDA3937_RS22560 in Dickeya dadantii 3937
Annotation: membrane protein insertion efficiency factor YidD
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 85% identical to YIDD_SODGM: Putative membrane protein insertion efficiency factor (SG2430) from Sodalis glossinidius (strain morsitans)
KEGG orthology group: K08998, hypothetical protein (inferred from 99% identity to dze:Dd1591_4265)Predicted SEED Role
"Protein YidD"
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See E0SNF9 at UniProt or InterPro
Protein Sequence (85 amino acids)
>DDA3937_RS22560 membrane protein insertion efficiency factor YidD (Dickeya dadantii 3937) MAPSLSFGSRLLIGLIRGYQRFISPLLGPHCRFQPSCSQYGIEAIRRFGMIKGSWLTLKR VLKCHPLNPGGDDPVPPKPDNNREH