Protein Info for DDA3937_RS22535 in Dickeya dadantii 3937

Annotation: DMT family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 299 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 29 to 47 (19 residues), see Phobius details amino acids 57 to 76 (20 residues), see Phobius details amino acids 85 to 105 (21 residues), see Phobius details amino acids 112 to 131 (20 residues), see Phobius details amino acids 137 to 158 (22 residues), see Phobius details amino acids 172 to 191 (20 residues), see Phobius details amino acids 203 to 222 (20 residues), see Phobius details amino acids 234 to 253 (20 residues), see Phobius details amino acids 259 to 280 (22 residues), see Phobius details PF00892: EamA" amino acids 3 to 128 (126 residues), 40.7 bits, see alignment E=1.3e-14 amino acids 138 to 275 (138 residues), 41 bits, see alignment E=1.1e-14 TIGR00950: carboxylate/amino acid/amine transporter" amino acids 11 to 273 (263 residues), 259.2 bits, see alignment E=2.1e-81

Best Hits

Swiss-Prot: 67% identical to BIOP_SALTY: Biotin transporter (bioP) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: None (inferred from 100% identity to ddd:Dda3937_02051)

MetaCyc: 67% identical to biotin transporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-240

Predicted SEED Role

"FIG00639538: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SLJ4 at UniProt or InterPro

Protein Sequence (299 amino acids)

>DDA3937_RS22535 DMT family transporter (Dickeya dadantii 3937)
MPLLIITTILWSFSFSLIGEYLAGQVDSWFSAMFRLVLAALVFLPFLRWRGYSPKVLGLY
LLVGVFQLGVMYLFLFRSYLYLNVPTILLFSVMTPLYVTLIYDLLSGHRLRWGYAFSALL
AVLGAAVIHYHGVSDHFWWGLLLVQAANVCFAVGQVGYKRLMEVYPMPQHSAFSWFYLGA
ALVTLVAWALVGNLTKLPTAPVQWGVLVFLGVVVSGLGYFMWNYGATQVDSGTLSIMNNF
HVPAGLLVNFAFWQKTPNWTSFLIGSAIIAAALWVHQCWVVKHPAQTADARRHAGARNE