Protein Info for DDA3937_RS21495 in Dickeya dadantii 3937

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 630 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 42 to 62 (21 residues), see Phobius details amino acids 70 to 89 (20 residues), see Phobius details amino acids 94 to 116 (23 residues), see Phobius details amino acids 134 to 153 (20 residues), see Phobius details amino acids 159 to 179 (21 residues), see Phobius details amino acids 211 to 228 (18 residues), see Phobius details amino acids 248 to 266 (19 residues), see Phobius details amino acids 278 to 308 (31 residues), see Phobius details amino acids 338 to 358 (21 residues), see Phobius details amino acids 370 to 390 (21 residues), see Phobius details PF07690: MFS_1" amino acids 26 to 341 (316 residues), 52.1 bits, see alignment E=1.2e-17 PF13489: Methyltransf_23" amino acids 448 to 599 (152 residues), 57.7 bits, see alignment E=3.1e-19 PF13649: Methyltransf_25" amino acids 464 to 553 (90 residues), 33.3 bits, see alignment E=1.6e-11 PF08241: Methyltransf_11" amino acids 465 to 557 (93 residues), 27.6 bits, see alignment E=9.2e-10

Best Hits

KEGG orthology group: None (inferred from 100% identity to ddd:Dda3937_01102)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SDQ8 at UniProt or InterPro

Protein Sequence (630 amino acids)

>DDA3937_RS21495 MFS transporter (Dickeya dadantii 3937)
MVYSIKDVNLIRLVSIPWGFLLLNGITFPFLIHKGLSVSEVFMIQSILAFSMVVAEVPSG
LFTDRFGNKSALLLAGLFKGIGGMMAWALDGFFAMAITWIFIGLANSFYSGTNLSVIYRS
SLNQERKTGIFSDIYQWGNCSFYLAIFLGAWISKYSIEIAALINGLVACTPVVIFSFISK
DSRFEVVKKEVNKTSVLEKIKLSFSFSGNKGMVLSLFAFSAVFCVIFNQSSNLVQVFLLA
KGFEAHQIGLAVGGLGLLGLFLTKLLSRKILALSVSQTVFLVIGLTLAALSLFMNGVVAV
FIAGAILLELVKYLTEVYIVDAINRSYQGDMIASLNSLLSLVKRFAVMLFAPLIGVLLEK
HGLDITLKSLTCFYLVISAMVAASIFFMSLKLKKHTSSENRLVRTAMKKSDVVEQIPEFG
EYQQTLYASFDQHYKEGRDGWSGAEASRKTTLKLLGLLKRSSSVLDIGCGKGIESKVIAE
QGHKVLGIDIIDSFEFPPDRTLDLNFRVGNFLGDSLVFEKYDAVLDNGCFHHQHPSLYIT
YLQKVYDCLNDDGFFAISIFATEDERQDKGEIYVHKDGRLGKEFSAAEIMALFSQAGFTA
CYQERYIRDNIPLPNYLCVFQKNLAAEGRA