Protein Info for DDA3937_RS21490 in Dickeya dadantii 3937

Annotation: diguanylate cyclase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 771 PF01590: GAF" amino acids 24 to 148 (125 residues), 43.6 bits, see alignment E=1.5e-14 PF13185: GAF_2" amino acids 32 to 150 (119 residues), 29.2 bits, see alignment E=3.5e-10 amino acids 440 to 586 (147 residues), 66.4 bits, see alignment E=1.2e-21 PF08447: PAS_3" amino acids 189 to 274 (86 residues), 40.9 bits, see alignment E=7.2e-14 amino acids 317 to 406 (90 residues), 77.3 bits, see alignment E=3.2e-25 TIGR00229: PAS domain S-box protein" amino acids 296 to 416 (121 residues), 49.7 bits, see alignment E=3.9e-17 PF13426: PAS_9" amino acids 317 to 411 (95 residues), 20.9 bits, see alignment E=1.3e-07 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 606 to 769 (164 residues), 140.6 bits, see alignment E=3.8e-45 PF00990: GGDEF" amino acids 608 to 767 (160 residues), 129.9 bits, see alignment E=2.8e-41

Best Hits

KEGG orthology group: None (inferred from 100% identity to ddd:Dda3937_01101)

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SDQ7 at UniProt or InterPro

Protein Sequence (771 amino acids)

>DDA3937_RS21490 diguanylate cyclase (Dickeya dadantii 3937)
MKKYNTDAQRVAKINEYHLLDLHLQQSFQNQVRLFARILNFPAAFISIIDHDKQWLIFSE
GLNIECTDREVAFCNTVIATAATMCIPDTLTNSQFREHPLVTGAPHIRSYFGIPLVLDKV
VVGTLAAIDYQPRNLDEATRETASFVASTTESLFKLHNEQLHREQEIRLLNNSSVVLVNW
QQDNMLHISYISPNAQHVLGLTEEELRHNNTVMESYVHSDDYENLLFTLDNHKKGVANLE
CEYRFLSPRGKTLWIRQLSIANYHHNGKLSHVQALLIDNSHQKYLQKLLVDTNNQMRLVL
ESSSLGTWDWDLGRHNIRVNKQWCEMMGVTQDQFDSSMDYWQQLMHPLDREKMVLAAEAC
ITGQATLINEQYRMRHNKGHWVWIETYGKVVEYNEKGKPIRVAGTHRDITEKKNKELQEE
ADKRLLELINRAQKIFLEKTDIQEACMSIFDDLLSISESEFGFIGQVREHDEKKVLHIVA
ISNVSWNGDSKNSYDTFLQNRLQFTSLDNLFGHVVITGKPVITNSPRSHSASRGVPSGHP
ILRQFMGLPIYFRNEVVGMIGLGNRFDGYNERQLRFLSPFVDTLGSLFYALETQRAREEL
EEKLLEMANTDVLTGIHNRRAYILETEKCYRNHEKNTALAIIDIDFFKKVNDQYGHHVGD
VAICRLAEIITSKLRTDDFVARLGGEEFGLIVHNANLDNVDAIMNGIRTEVENTLFTVDG
YSFHFTVSIGATFIKHRNVQSLKDSFESDMKRADDALYEAKNAGRNRVVWK