Protein Info for DDA3937_RS21480 in Dickeya dadantii 3937

Annotation: P-loop NTPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 438 PF02374: ArsA_ATPase" amino acids 127 to 163 (37 residues), 25.4 bits, see alignment 2e-09 PF10609: ParA" amino acids 128 to 180 (53 residues), 32.8 bits, see alignment 1.3e-11 PF01656: CbiA" amino acids 128 to 245 (118 residues), 30.3 bits, see alignment E=9.4e-11 PF13614: AAA_31" amino acids 128 to 166 (39 residues), 29.3 bits, see alignment 2e-10

Best Hits

KEGG orthology group: None (inferred from 100% identity to ddd:Dda3937_01099)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SDQ5 at UniProt or InterPro

Protein Sequence (438 amino acids)

>DDA3937_RS21480 P-loop NTPase (Dickeya dadantii 3937)
MTTFDQILPAIEGILNPHTELIGHIQPVVINRDLNGKVRLIVSVSVHNNPEQQAAVSAIA
EQLSAELAPHSFTPDSTVLYESNVESVYQCAAHFALADDIPGVYVVDRLATESRWDMITP
ESNGASRIVFFSIKGGVGRSTAITACAWALAQSGKKVMVLDLDLESPGLSTALLPEDRRP
TYGIADWLVEDLVDNGHNLLGDMIATSTLSHDGDIYVIPAHGKNPGEYIAKLGRVWMPKI
DRNSNRESWSHRLHRLIDQLEERIKPDVILIDSRSGIDEVASSCVTDIGAKTVLLFTLDG
EQTWSGYRVLFDYWNRSGKAADIRERLQLIGAMIPDDERRESYFSGLCENAYELFSSTLY
DEVPPGETVENLFSFEMNDESAPHYPWAIRWNRGFSALTSLHSRFEQNTIDSAEVQSIFG
TLIEGIQSLTSYPGEHDE