Protein Info for DDA3937_RS21440 in Dickeya dadantii 3937

Annotation: amino acid ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 248 transmembrane" amino acids 26 to 51 (26 residues), see Phobius details amino acids 62 to 85 (24 residues), see Phobius details amino acids 107 to 131 (25 residues), see Phobius details amino acids 185 to 203 (19 residues), see Phobius details amino acids 215 to 236 (22 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 22 to 89 (68 residues), 62.7 bits, see alignment E=2e-21 PF00528: BPD_transp_1" amino acids 43 to 231 (189 residues), 49.1 bits, see alignment E=2.9e-17

Best Hits

KEGG orthology group: K02029, polar amino acid transport system permease protein (inferred from 100% identity to ddd:Dda3937_01091)

Predicted SEED Role

"Glutamate Aspartate transport system permease protein GltJ (TC 3.A.1.3.4)" (TC 3.A.1.3.4)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SDP7 at UniProt or InterPro

Protein Sequence (248 amino acids)

>DDA3937_RS21440 amino acid ABC transporter permease (Dickeya dadantii 3937)
MMTDESIRQWLTDWLLAPQYLQWLWQGFQVTLGIAAATVVLATALGLVLAAGRDSRTPLL
RWLAIAYCSLFRNTPLLVQLFFWYFGAAQLLPAGLMQWLNSPHVIPLLGLNGPSFEFLAG
LFGLTLYSAAFIAEEIRAGIAGVAHGQKYAACALGLTDWQAMRYVVLPQALRIALPPLLG
QYMNVIKNSSLAMAIGVAELSYASRQVETETLRTFQAFGVATVFYIAAIALLEGWGQWRQ
HRQPLKGH