Protein Info for DDA3937_RS21410 in Dickeya dadantii 3937

Annotation: formate-dependent uric acid utilization protein AegA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 664 PF13247: Fer4_11" amino acids 53 to 139 (87 residues), 50.4 bits, see alignment E=1.4e-16 PF13237: Fer4_10" amino acids 83 to 133 (51 residues), 24.7 bits, see alignment 1.2e-08 PF00037: Fer4" amino acids 83 to 103 (21 residues), 32 bits, see alignment (E = 5e-11) PF12837: Fer4_6" amino acids 84 to 102 (19 residues), 24.1 bits, see alignment (E = 1.7e-08) PF13187: Fer4_9" amino acids 86 to 136 (51 residues), 27.3 bits, see alignment 1.9e-09 TIGR01318: glutamate synthase, small subunit" amino acids 185 to 643 (459 residues), 783.2 bits, see alignment E=3.6e-240 PF14691: Fer4_20" amino acids 199 to 309 (111 residues), 122.6 bits, see alignment E=4.8e-39 PF07992: Pyr_redox_2" amino acids 323 to 632 (310 residues), 77.7 bits, see alignment E=7e-25 PF00070: Pyr_redox" amino acids 323 to 394 (72 residues), 24.1 bits, see alignment E=2.8e-08 PF01494: FAD_binding_3" amino acids 324 to 354 (31 residues), 27 bits, see alignment (E = 1.8e-09) PF13450: NAD_binding_8" amino acids 326 to 360 (35 residues), 34.4 bits, see alignment (E = 1.4e-11)

Best Hits

KEGG orthology group: None (inferred from 100% identity to ddd:Dda3937_01085)

Predicted SEED Role

"Glutamate synthase [NADPH] small chain (EC 1.4.1.13)" in subsystem Ammonia assimilation or Glutamine, Glutamate, Aspartate and Asparagine Biosynthesis (EC 1.4.1.13)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.4.1.13

Use Curated BLAST to search for 1.4.1.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SD11 at UniProt or InterPro

Protein Sequence (664 amino acids)

>DDA3937_RS21410 formate-dependent uric acid utilization protein AegA (Dickeya dadantii 3937)
MNQFVIANAKDCIGCNACEIACVISHNHGRYPENRDDFHPRIRVFHQGEQHTAVTCRHCE
DSPCAKVCPTQALVRKQDGIQLVAEKCIGCKTCVLACPFGAISVETQSQGAIAHKCDLCI
GRPEGQACVEACPTQALHLVSERSLEEQRRTKQLRMAQTAIPGTTRPIPTFAEIACRPLD
KRKNWPRRDAVKKPLEERVTTFGEIYHGFSAEQTLDQASRCLHCGQHAVCEWTCPLHNNI
PALLQLVQEGRILDAVELSHRTSSLPEICGRVCPQDRLCEGACTLGKGYGAVTVGNIERY
ITDTAMSMGWQPDLSRVKPTGKRAAIIGAGPAGLACADVLARHGVQAVVFDRHPEIGGLL
TFGIPAFKLDKSVLTRRREIFSAMGIEFRLNTEVGTDIGMAQLMAEFDTVFLGVGTYRSM
KAGLENEDAPGVYDALPFLIANTKRVMELSALPDEPYVSMQGKRVLVLGGGDTAMDCLRT
SIRQGAASVTCAYRRDEANMPGSRKEVKNSREEGVEFLFNVQPLKICLNDNGEVCGVSLI
RTEMGEPDASGRRRPKPVPGSEFVQPAEAVITAFGFQAHSMPWLQDAHIALDRWGHITTT
HRLPCQTNHPQVFAGGDAVRGADLVVTAIADGRKAAQGMLRVMGLESQDMSLPVNAVVQQ
ENRP