Protein Info for DDA3937_RS21410 in Dickeya dadantii 3937

Annotation: formate-dependent uric acid utilization protein AegA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13247: Fer4_11
  • amino acids 53 to 139 (87 residues), 50.4 bits, E=1.4e-16
• PF13237: Fer4_10
  • amino acids 83 to 133 (51 residues), 24.7 bits, 1.2e-08
• PF00037: Fer4
  • amino acids 83 to 103 (21 residues), 32 bits, see alignment (E = 5e-11)
• PF12837: Fer4_6
  • amino acids 84 to 102 (19 residues), 24.1 bits, see alignment (E = 1.7e-08)
• PF13187: Fer4_9
  • amino acids 86 to 136 (51 residues), 27.3 bits, 1.9e-09
• TIGR01318: glutamate synthase, small subunit
  • amino acids 185 to 643 (459 residues), 783.2 bits, E=3.6e-240
• PF14691: Fer4_20
  • amino acids 199 to 309 (111 residues), 122.6 bits, E=4.8e-39
• PF07992: Pyr_redox_2
  • amino acids 323 to 632 (310 residues), 77.7 bits, E=7e-25
• PF00070: Pyr_redox
  • amino acids 323 to 394 (72 residues), 24.1 bits, E=2.8e-08
• PF01494: FAD_binding_3
  • amino acids 324 to 354 (31 residues), 27 bits, see alignment (E = 1.8e-09)
• PF13450: NAD_binding_8
  • amino acids 326 to 360 (35 residues), 34.4 bits, see alignment (E = 1.4e-11)

Best Hits

KEGG orthology group: None (inferred from 100% identity to ddd:Dda3937_01085)

Predicted SEED Role

"Glutamate synthase [NADPH] small chain (EC 1.4.1.13)" in subsystem Ammonia assimilation or Glutamine, Glutamate, Aspartate and Asparagine Biosynthesis (EC 1.4.1.13)

MetaCyc Pathways

• ammonia assimilation cycle III (3/3 steps found)
• L-glutamate biosynthesis I (2/2 steps found)
• L-glutamine degradation I (1/1 steps found)
• L-glutamine degradation II (1/1 steps found)
• L-asparagine biosynthesis III (tRNA-dependent) (3/4 steps found)
• glutaminyl-tRNA^gln biosynthesis via transamidation (3/4 steps found)
• L-glutamate and L-glutamine biosynthesis (5/7 steps found)
• L-citrulline biosynthesis (5/8 steps found)
• superpathway of L-citrulline metabolism (7/12 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Glutamate metabolism
• Nitrogen metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.4.1.13

Use Curated BLAST to search for 1.4.1.13

Sequence Analysis Tools

See E0SD11 at UniProt or InterPro

Protein Sequence (664 amino acids)

>DDA3937_RS21410 formate-dependent uric acid utilization protein AegA (Dickeya dadantii 3937)
MNQFVIANAKDCIGCNACEIACVISHNHGRYPENRDDFHPRIRVFHQGEQHTAVTCRHCE
DSPCAKVCPTQALVRKQDGIQLVAEKCIGCKTCVLACPFGAISVETQSQGAIAHKCDLCI
GRPEGQACVEACPTQALHLVSERSLEEQRRTKQLRMAQTAIPGTTRPIPTFAEIACRPLD
KRKNWPRRDAVKKPLEERVTTFGEIYHGFSAEQTLDQASRCLHCGQHAVCEWTCPLHNNI
PALLQLVQEGRILDAVELSHRTSSLPEICGRVCPQDRLCEGACTLGKGYGAVTVGNIERY
ITDTAMSMGWQPDLSRVKPTGKRAAIIGAGPAGLACADVLARHGVQAVVFDRHPEIGGLL
TFGIPAFKLDKSVLTRRREIFSAMGIEFRLNTEVGTDIGMAQLMAEFDTVFLGVGTYRSM
KAGLENEDAPGVYDALPFLIANTKRVMELSALPDEPYVSMQGKRVLVLGGGDTAMDCLRT
SIRQGAASVTCAYRRDEANMPGSRKEVKNSREEGVEFLFNVQPLKICLNDNGEVCGVSLI
RTEMGEPDASGRRRPKPVPGSEFVQPAEAVITAFGFQAHSMPWLQDAHIALDRWGHITTT
HRLPCQTNHPQVFAGGDAVRGADLVVTAIADGRKAAQGMLRVMGLESQDMSLPVNAVVQQ
ENRP