Protein Info for DDA3937_RS21370 in Dickeya dadantii 3937

Annotation: lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 552 transmembrane" amino acids 7 to 27 (21 residues), see Phobius details amino acids 82 to 101 (20 residues), see Phobius details amino acids 113 to 133 (21 residues), see Phobius details amino acids 139 to 153 (15 residues), see Phobius details amino acids 165 to 194 (30 residues), see Phobius details amino acids 204 to 227 (24 residues), see Phobius details amino acids 258 to 281 (24 residues), see Phobius details amino acids 292 to 310 (19 residues), see Phobius details amino acids 316 to 334 (19 residues), see Phobius details amino acids 346 to 369 (24 residues), see Phobius details amino acids 381 to 401 (21 residues), see Phobius details amino acids 407 to 427 (21 residues), see Phobius details PF02366: PMT" amino acids 9 to 237 (229 residues), 151.1 bits, see alignment E=4.2e-48 PF13231: PMT_2" amino acids 61 to 222 (162 residues), 49.9 bits, see alignment E=4.4e-17

Best Hits

Swiss-Prot: 61% identical to ARNT2_SODGM: Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase 2 (arnT2) from Sodalis glossinidius (strain morsitans)

KEGG orthology group: K07264, 4-amino-4-deoxy-L-arabinose transferase [EC: 2.-.-.-] (inferred from 100% identity to ddd:Dda3937_01076)

MetaCyc: 59% identical to lipid IVA 4-amino-4-deoxy-L-arabinosyltransferase (Escherichia coli K-12 substr. MG1655)
RXN0-2001 [EC: 2.4.2.43]

Predicted SEED Role

"Polymyxin resistance protein ArnT, undecaprenyl phosphate-alpha-L-Ara4N transferase; Melittin resistance protein PqaB"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.-.-.-

Use Curated BLAST to search for 2.-.-.- or 2.4.2.43

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SD02 at UniProt or InterPro

Protein Sequence (552 amino acids)

>DDA3937_RS21370 lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase (Dickeya dadantii 3937)
MKYARQTTLWLVLLLLYYFIPLNGRLLWQPDETRYAEISREMLAGGNWIAPHFLGIRYFE
KPIAGYWVNSIGQWLLGDNNAGVRAGVVFSILLTAALIYWLTQRLWQQRRTSLLAAAIYL
SCLLVYGIGTYAVLDPIVTLWLAAAMCSFWGAAQATTRGSKIGGYLLLGVVCGMGFMTKG
FLALAVPVIAVLPWVALERRWKEVLLYGPLAIVSAVAVSLPWALAVARQQPDFWHYFFWV
EHIQRFADSANAQHKAPFWYYLPVLIGGVLPWLALLPSSLLQGWRERRQESGAFYLLGWV
VMPFLFFSIAKGKLPTYILPCFAPLAILMARRATTLLNPRLLTINGWINLAFGLLCALIV
VLVLAPWGLSHRPLYQPQETVKVALGVVAFLFWGLVGWWTLRHAAARWHWAAACPLGIAL
LIGMAIPQRVMESKHPQWFLRAPEVESRLSQSRYILANSVGVASAVAWEQKRGDILMYDN
QGELEYGLSYPDSANRMVPADAFADWLATHRREGNVSLVLIFSSATDPITGVPPADYTDR
KGRVALLWYRQQ