Protein Info for DDA3937_RS21350 in Dickeya dadantii 3937

Annotation: GNAT family N-acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 159 PF13673: Acetyltransf_10" amino acids 37 to 136 (100 residues), 37.3 bits, see alignment E=3.8e-13 PF00583: Acetyltransf_1" amino acids 42 to 136 (95 residues), 80.4 bits, see alignment E=2e-26 PF13508: Acetyltransf_7" amino acids 53 to 136 (84 residues), 52.1 bits, see alignment E=1.1e-17

Best Hits

Swiss-Prot: 42% identical to SAT2_PIG: Diamine acetyltransferase 2 (SAT2) from Sus scrofa

KEGG orthology group: None (inferred from 100% identity to ddd:Dda3937_01072)

Predicted SEED Role

"Diamine acetyltransferase (EC 2.3.1.57)" (EC 2.3.1.57)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.57

Use Curated BLAST to search for 2.3.1.57

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SCZ8 at UniProt or InterPro

Protein Sequence (159 amino acids)

>DDA3937_RS21350 GNAT family N-acetyltransferase (Dickeya dadantii 3937)
MTLHIRWAAQQDSATILNFIRELAEYEKALHEVKTNQQEIEQTLFGEGTSTEALICEWNG
EPIGFAVFFTSYSTWLGRDGIYLEDLYVSPHYRGQGAGKALLKYIARLAVERGCGRLEWS
VLDWNQPAIDFYDSLGAAPQNEWIRYRLEGDSLRQAAQE