Protein Info for DDA3937_RS21335 in Dickeya dadantii 3937

Annotation: 4-hydroxyphenylpyruvate dioxygenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF14696: Glyoxalase_5
  • amino acids 6 to 142 (137 residues), 158 bits, E=2.7e-50
• TIGR01263: 4-hydroxyphenylpyruvate dioxygenase
  • amino acids 13 to 354 (342 residues), 367.3 bits, E=5.2e-114
• PF00903: Glyoxalase
  • amino acids 160 to 274 (115 residues), 53.5 bits, E=4.7e-18
• PF13669: Glyoxalase_4
  • amino acids 177 to 267 (91 residues), 32 bits, E=2e-11

Best Hits

Swiss-Prot: 56% identical to HPPD_PSEUJ: 4-hydroxyphenylpyruvate dioxygenase (hpd) from Pseudomonas sp. (strain P.J. 874)

KEGG orthology group: K00457, 4-hydroxyphenylpyruvate dioxygenase [EC: 1.13.11.27] (inferred from 100% identity to ddd:Dda3937_01069)

MetaCyc: 56% identical to 4-hydroxyphenylpyruvate dioxygenase subunit (Pseudomonas sp. P.J. 874)
4-hydroxyphenylpyruvate dioxygenase. [EC: 1.13.11.27]

Predicted SEED Role

"4-hydroxyphenylpyruvate dioxygenase (EC 1.13.11.27)" in subsystem Aromatic amino acid degradation or Homogentisate pathway of aromatic compound degradation or Plastoquinone Biosynthesis or Tocopherol Biosynthesis (EC 1.13.11.27)

MetaCyc Pathways

• plastoquinol-9 biosynthesis I (1/3 steps found)
• L-tyrosine degradation I (2/5 steps found)
• superpathway of plastoquinol biosynthesis (2/5 steps found)
• L-phenylalanine degradation IV (mammalian, via side chain) (3/9 steps found)
• vitamin E biosynthesis (tocopherols) (1/7 steps found)

KEGG Metabolic Maps

• Phenylalanine metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.13.11.27

Sequence Analysis Tools

See E0SCZ5 at UniProt or InterPro

Protein Sequence (361 amino acids)

>DDA3937_RS21335 4-hydroxyphenylpyruvate dioxygenase (Dickeya dadantii 3937)
MDELLTNPLELNGFAFIEFVTDAPETLSSLFFSLGFTRVAHHRHRDISLFRQNDINFLVN
NTAAGFPQTFLQEHGAGACGIGFYVRDAAQAYEQALLSGARPASQTASPGEVLIPAIEGI
GGSRIYFIEKYHTDIDIFDIDFTFTPDVERKPKGFGLHTLDHLTNNVYQGRMNYWSEFYS
RIFNFQQIRYFDIAGEYTGLHSKAMVAPDGKIRIPLNEEAEGSNGQIQEFLRRFNGEGIQ
HIAMQTDDILTTLDRLRQAGLPLMTAPSDTYYQMVEERLPGHGRDIAALQTRGILIDGNT
RNGQKKLLLQIFSETLIGPLFFEFIERDGDDGFGEGNFKALFESMERDQLARGEIKATGA
A