Protein Info for DDA3937_RS21295 in Dickeya dadantii 3937

Annotation: chromosomal replication initiator protein DnaA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 462 PF11638: DnaA_N" amino acids 4 to 64 (61 residues), 68.7 bits, see alignment E=7e-23 TIGR00362: chromosomal replication initiator protein DnaA" amino acids 6 to 460 (455 residues), 620.4 bits, see alignment E=1e-190 PF00308: Bac_DnaA" amino acids 128 to 344 (217 residues), 332.6 bits, see alignment E=3.3e-103 PF01695: IstB_IS21" amino acids 163 to 265 (103 residues), 34.3 bits, see alignment E=4.6e-12 PF00004: AAA" amino acids 164 to 265 (102 residues), 26.3 bits, see alignment E=2.2e-09 PF08299: Bac_DnaA_C" amino acids 371 to 439 (69 residues), 112.4 bits, see alignment E=2e-36

Best Hits

Swiss-Prot: 94% identical to DNAA_PECCP: Chromosomal replication initiator protein DnaA (dnaA) from Pectobacterium carotovorum subsp. carotovorum (strain PC1)

KEGG orthology group: K02313, chromosomal replication initiator protein (inferred from 100% identity to ddd:Dda3937_01060)

Predicted SEED Role

"Chromosomal replication initiator protein DnaA" in subsystem DNA-replication

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SNF6 at UniProt or InterPro

Protein Sequence (462 amino acids)

>DDA3937_RS21295 chromosomal replication initiator protein DnaA (Dickeya dadantii 3937)
MSLSLWQQCLARLQDELPATEFSMWIRPLQAELSDNTLALYAPNRFVLDWVRDKYINNIN
GLLNDFCGMDAPLLRFEVGSKPMTPAVVSTGHHSAAAPAPQARAASPVRPSWETPAAQAE
HTYRSNVNPKHTFDNFVEGKSNQLARAAARQVADNPGGAYNPLFLYGGTGLGKTHLLHAV
GNGIIARKPNAKVVYMHSERFVQDMVKALQNNAIEEFKRYYRSVDALLIDDIQFFANKER
SQEEFFHTFNALLEGNQQIILTSDRYPKEINGVEDRLKSRFGWGLTVAIEPPELETRVAI
LMKKADENDIRLPGEVAFFIAKRLRSNVRELEGALNRVIANANFTGRSITIDFVREALRD
LLALQEKLVTIDNIQKTVAEYYKIKVADLLSKRRSRSVARPRQMAMALAKELTNHSLPEI
GDAFGGRDHTTVLHACRKIEQLREESHDIKEDFSNLIRTLSS