Protein Info for DDA3937_RS21060 in Dickeya dadantii 3937

Annotation: glycine--tRNA ligase subunit alpha

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 304 TIGR00388: glycine--tRNA ligase, alpha subunit" amino acids 7 to 300 (294 residues), 586 bits, see alignment E=6.4e-181 PF02091: tRNA-synt_2e" amino acids 9 to 292 (284 residues), 498.1 bits, see alignment E=3.2e-154

Best Hits

Swiss-Prot: 98% identical to SYGA_CROS8: Glycine--tRNA ligase alpha subunit (glyQ) from Cronobacter sakazakii (strain ATCC BAA-894)

KEGG orthology group: K01878, glycyl-tRNA synthetase alpha chain [EC: 6.1.1.14] (inferred from 98% identity to eok:G2583_4301)

MetaCyc: 98% identical to glycine--tRNA ligase subunit alpha (Escherichia coli K-12 substr. MG1655)
Glycine--tRNA ligase. [EC: 6.1.1.14]

Predicted SEED Role

"Glycyl-tRNA synthetase alpha chain (EC 6.1.1.14)" (EC 6.1.1.14)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.1.1.14

Use Curated BLAST to search for 6.1.1.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SNA5 at UniProt or InterPro

Protein Sequence (304 amino acids)

>DDA3937_RS21060 glycine--tRNA ligase subunit alpha (Dickeya dadantii 3937)
MQKFDTKTFQGLILTLQDYWARQGCTIVQPLDMEVGAGTSHPMTCLRALGPEPIAAAYVQ
PSRRPTDGRYGENPNRLQHYYQFQVIIKPSPDNIQELYLGSLKELGMDPTIHDIRFVEDN
WENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECKPVTGEITYGLERLAMYIQGVDSV
YDLVWSNGPLGKTTYGDVFHQNEVEQSTYNFEYADVDFLFTCFEQYEKEAQQLLALEKPL
PLPAYERILKAAHSFNLLDARKAISVTERQRYILRIRTLTKAVAEAYYASREALGFPMCN
RKQS