Protein Info for DDA3937_RS21025 in Dickeya dadantii 3937

Annotation: sugar ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 315 transmembrane" amino acids 29 to 50 (22 residues), see Phobius details amino acids 97 to 120 (24 residues), see Phobius details amino acids 132 to 151 (20 residues), see Phobius details amino acids 180 to 205 (26 residues), see Phobius details amino acids 226 to 247 (22 residues), see Phobius details amino acids 286 to 308 (23 residues), see Phobius details PF00528: BPD_transp_1" amino acids 115 to 312 (198 residues), 63.6 bits, see alignment E=1e-21

Best Hits

KEGG orthology group: None (inferred from 100% identity to ddc:Dd586_0052)

Predicted SEED Role

"Probable sugar-transport integral membrane protein ABC transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SN98 at UniProt or InterPro

Protein Sequence (315 amino acids)

>DDA3937_RS21025 sugar ABC transporter permease (Dickeya dadantii 3937)
MKVMNPESASLAVMSQGSGVFTRRLRKYWPYLLILPSFGLLLLFTFYPLLQGFWMSVFQR
GVVVLPQVASTQPKFVGIDNFIQVFTDPEFQHVLLRTVVFVVFAVPLNLVIALCMALLLA
PQMRGFGLARTIVFFPSMISLLTIGIMWKWLFGYNSGLINYVLSLVDISPVPWLQQETMA
QIAVVIVWVWASAGFNMMILLAGLTAIPEDLYEASRMDGTSRWRTFWRITLPLLQPSVVV
VVVLSSIEAFKVYELVISLTGGGPGRATVYLIQTIYENAFMQPATAGVAAAQSVVLFVIL
FALSVIQLRLSRSFK