Protein Info for DDA3937_RS20985 in Dickeya dadantii 3937

Annotation: DUF3053 domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 236 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details PF11254: DUF3053" amino acids 14 to 230 (217 residues), 307.2 bits, see alignment E=3.4e-96

Best Hits

Swiss-Prot: 46% identical to YIAF_ECO57: Uncharacterized protein YiaF (yiaF) from Escherichia coli O157:H7

KEGG orthology group: None (inferred from 100% identity to ddd:Dda3937_00996)

Predicted SEED Role

"probable exported protein YPO4070"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SN90 at UniProt or InterPro

Protein Sequence (236 amino acids)

>DDA3937_RS20985 DUF3053 domain-containing protein (Dickeya dadantii 3937)
MMLADYRSRWLLPVVMLVAALQLSACGDKDKDARQAFITFLQGISQQEGRQLPALSEQQK
QSFGRFTQDYAVMTAFNQQLDQALAGSLTPMLDVVSRIRVPQDYVTQRDNLRQALGGLNM
LSPQVQNAKTQADNAHRALKQPEELQTVYDKVYNRAVSLPANAMVTVVPASTSFAQSVVQ
VGDYLQTQGNQVVFGNNGVQFHTQQQVDQYNSMMTDIANQQQKLFTTLKSQNFLPH