Protein Info for DDA3937_RS20970 in Dickeya dadantii 3937

Annotation: mannitol operon repressor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 176 transmembrane" amino acids 22 to 43 (22 residues), see Phobius details amino acids 155 to 172 (18 residues), see Phobius details PF05068: MtlR" amino acids 8 to 170 (163 residues), 230.4 bits, see alignment E=5.7e-73

Best Hits

Swiss-Prot: 76% identical to MTLR_ECOLI: Mannitol operon repressor (mtlR) from Escherichia coli (strain K12)

KEGG orthology group: K02562, mannitol operon repressor (inferred from 100% identity to ddd:Dda3937_00993)

Predicted SEED Role

"Mannitol operon repressor" in subsystem Mannitol Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (176 amino acids)

>DDA3937_RS20970 mannitol operon repressor (Dickeya dadantii 3937)
MDDTQAFENRVLESLNASKTVRSFMLMAVELLAEAVSLLMLQAFRKDDYAVKYAVEPLLS
GSGPLGELSVRLKLIYGLGMISRKEYEDTELLMALGEELTHDEHEYRFTDDEILGPISEL
HCVSSLPPSPMLPPSVDPDDALLAAMQQQRYQQMVRSTLVLSLTELIAGISLKKAF