Protein Info for DDA3937_RS20965 in Dickeya dadantii 3937

Annotation: methyl-accepting chemotaxis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 628 transmembrane" amino acids 14 to 35 (22 residues), see Phobius details amino acids 279 to 299 (21 residues), see Phobius details PF16591: HBM" amino acids 42 to 271 (230 residues), 75.5 bits, see alignment E=7.2e-25 PF00672: HAMP" amino acids 299 to 349 (51 residues), 41.9 bits, see alignment 1.6e-14 PF00015: MCPsignal" amino acids 414 to 568 (155 residues), 190.3 bits, see alignment E=4e-60

Best Hits

KEGG orthology group: None (inferred from 100% identity to ddd:Dda3937_00992)

Predicted SEED Role

"Methyl-accepting chemotaxis protein I (serine chemoreceptor protein)" in subsystem Bacterial Chemotaxis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SN86 at UniProt or InterPro

Protein Sequence (628 amino acids)

>DDA3937_RS20965 methyl-accepting chemotaxis protein (Dickeya dadantii 3937)
MAIKLENIKVGRKLGLGFSLILLLTVIIAAVSVRYIETLKGRFEKVIFSNQISDEVNEAR
YYRVLYSISYNPDSIQQNTKHIDNIINLISSIQDKSWRGDYDDKLANIAKLISQYKERQK
NYTDAIAKKDDVRKSWNLSDSEKPLKQIEQQIAGNLPLQFQLSTLHQKLVTVRYLVRGLL
LSLNSDAEKPLVTALDDAQAALNQFIQALTPEQQAIMAPVVSTLSTYKTQVLAYLPAYQG
EMNQAKQLGETANQLLDNVDKMVTEETAATQNDITNAEWQIAITALITLILGVLIAWYIS
RQITHPLNNTVAIAESIATGDLTISIETTRRDELGMLYGAMAKMKANLHNMIDDIRMGVS
QITTAASEIVTGNNDLAARTESQAASVEETAASMEQLTSTVKQNAANAHQANKLVLDATE
TAKAGGKLVEDVVQTMSDIEGSSKRIAEITSVINGIAFQTNILALNAAVEAARAGEQGRG
FAVVANEVRNLAQRSSQAAKEIEGLISTSVDQVSKGAHLVHNAGKTMQEIVTAVTHVHDI
MGEITVASDEQSRGIAQVNQAIVEMDSTTQQNAALVQQSSAAASSLEEQAVMLSNTVSAF
RLSSAHELAPASHGLPFAGHHQQLSYKR