Protein Info for DDA3937_RS20955 in Dickeya dadantii 3937

Annotation: formate dehydrogenase accessory sulfurtransferase FdhD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 284 TIGR00129: formate dehydrogenase family accessory protein FdhD" amino acids 43 to 283 (241 residues), 296.5 bits, see alignment E=6.4e-93 PF02634: FdhD-NarQ" amino acids 47 to 282 (236 residues), 232.7 bits, see alignment E=2.7e-73

Best Hits

Swiss-Prot: 81% identical to FDHD_PECCP: Sulfur carrier protein FdhD (fdhD) from Pectobacterium carotovorum subsp. carotovorum (strain PC1)

KEGG orthology group: K02379, FdhD protein (inferred from 100% identity to ddd:Dda3937_00989)

Predicted SEED Role

"Formate dehydrogenase chain D (EC 1.2.1.2)" in subsystem Formate hydrogenase (EC 1.2.1.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.2.1.2

Use Curated BLAST to search for 1.2.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SMJ5 at UniProt or InterPro

Protein Sequence (284 amino acids)

>DDA3937_RS20955 formate dehydrogenase accessory sulfurtransferase FdhD (Dickeya dadantii 3937)
MDSRNSGHNTVNNDDSQGLAERLIAGACQRTVWHQGELDTPRQDWLAEEVPVALVYNGIS
HVVMMVSPKDLEPFALGFSLSEGIIQSPQDIYGIDVVPVCNGIEVQIELSSRRFSGLKAR
RRAMDGRTGCGVCGVEQLEEIGKPVSPLPFTQHFSLSRLEQALQAMKSVQQAGALTGSTH
AAAWLSPEGELLGGCEDVGRHVALDKLLGTRARQPWQQGAALVSSRASYEMVQKSAMCGV
EILFAVSAATSLAVEVAARCNLTLVGFCRPGRATVYTHPQRLRA