Protein Info for DDA3937_RS20890 in Dickeya dadantii 3937

Annotation: argininosuccinate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00032: argininosuccinate synthase
  • amino acids 13 to 419 (407 residues), 557 bits, E=1.4e-171
• PF00764: Arginosuc_synth
  • amino acids 14 to 161 (148 residues), 69.5 bits, E=3.6e-23
• PF20979: Arginosuc_syn_C
  • amino acids 191 to 408 (218 residues), 109.6 bits, E=1.8e-35

Best Hits

Swiss-Prot: 100% identical to ASSY_DICD3: Argininosuccinate synthase (argG) from Dickeya dadantii (strain 3937)

KEGG orthology group: K01940, argininosuccinate synthase [EC: 6.3.4.5] (inferred from 100% identity to ddd:Dda3937_00977)

Predicted SEED Role

"Argininosuccinate synthase (EC 6.3.4.5)" in subsystem Arginine Biosynthesis extended (EC 6.3.4.5)

MetaCyc Pathways

• L-arginine biosynthesis I (via L-ornithine) (9/9 steps found)
• L-arginine biosynthesis II (acetyl cycle) (9/10 steps found)
• superpathway of arginine and polyamine biosynthesis (14/17 steps found)
• L-arginine biosynthesis III (via N-acetyl-L-citrulline) (8/9 steps found)
• nitric oxide biosynthesis II (mammals) (2/3 steps found)
• urea cycle (3/5 steps found)
• canavanine biosynthesis (2/4 steps found)
• superpathway of L-citrulline metabolism (7/12 steps found)
• L-arginine biosynthesis IV (archaea) (4/9 steps found)

KEGG Metabolic Maps

• Alanine and aspartate metabolism
• Arginine and proline metabolism
• Urea cycle and metabolism of amino groups

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.4.5

Sequence Analysis Tools

See P0C1A1 at UniProt or InterPro

Protein Sequence (449 amino acids)

>DDA3937_RS20890 argininosuccinate synthase (Dickeya dadantii 3937)
MTTILKHLPVGQRIGIAFSGGLDTSAALLWMRQKGAVPYAYTANLGQPDEDDYDAIPRRA
KEYGAENARLIDCRKQLVAEGIAAIQCGAFHNTTGGMTYFNTTPLGRAVTGTMLVAAMKE
DGVNIWGDGSTYKGNDIERFYRYGLLTNAELKIYKPWLDTDFIDELGGRQEMSEFMTTSG
FDYKMSAEKAYSTDSNMLGATHEAKDLEFLNSSVKIVNPIMGVKFWDENVRIPAEEVTVR
FERGHPVALNGQTFSDDVELLLEANRIGGRHGLGMSDQIENRIIEAKSRGIYEAPGMALL
HIAYERLVTGIHNEDTIEQYHAHGRQLGRLLYQGRWFDPQALMLRDALQRWVASEITGEV
TLELRRGNDYSILNTVSDNLTYKPERLTMEKGESVFSPDDRIGQLTMRNLDITDTREKLF
NYVESGLIFSGNAGLPQVANPSLQDKSAK