Protein Info for DDA3937_RS20375 in Dickeya dadantii 3937

Annotation: dienelactone hydrolase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 275 PF01738: DLH" amino acids 50 to 272 (223 residues), 235.3 bits, see alignment E=1.5e-73 PF02230: Abhydrolase_2" amino acids 136 to 245 (110 residues), 31.6 bits, see alignment E=3.9e-11 PF00326: Peptidase_S9" amino acids 187 to 271 (85 residues), 23.8 bits, see alignment E=7.3e-09

Best Hits

Swiss-Prot: 73% identical to DLHH_ECOLI: Putative carboxymethylenebutenolidase (ysgA) from Escherichia coli (strain K12)

KEGG orthology group: K01061, carboxymethylenebutenolidase [EC: 3.1.1.45] (inferred from 96% identity to ddc:Dd586_0177)

Predicted SEED Role

"Putative carboxymethylenebutenolidase (EC 3.1.1.45)" (EC 3.1.1.45)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.1.45

Use Curated BLAST to search for 3.1.1.45

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SLJ1 at UniProt or InterPro

Protein Sequence (275 amino acids)

>DDA3937_RS20375 dienelactone hydrolase family protein (Dickeya dadantii 3937)
MKTDELLTLRETTRAFSPAVMPLASSAITTDATGLVAGETTIPSQGDNLPAYIAKPEKAA
GPLPIVLVVQEIFGVHEHIRDVCRRLAKQGYLAIAPELYFRQGDPQQYSDIPTLLSELVN
KVPDNQVLSDLDHTAHWAVRQGGDASRLAITGFCWGGRISWLYAAHNPQLKATVAWYGKL
VAEKTLTSPQHPVDVAKDLSAPVLGLYGGQDKSIPLEQVETMRQALRAVNADAEIVVYPE
ADHAFHADYRATYHEASAKDGWQRMLEWFARYGVV