Protein Info for DDA3937_RS20345 in Dickeya dadantii 3937

Annotation: acetylglutamate kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 257 TIGR00761: acetylglutamate kinase" amino acids 4 to 233 (230 residues), 242.9 bits, see alignment E=1.6e-76 PF00696: AA_kinase" amino acids 4 to 234 (231 residues), 150.6 bits, see alignment E=3.2e-48

Best Hits

Swiss-Prot: 92% identical to ARGB_PECCP: Acetylglutamate kinase (argB) from Pectobacterium carotovorum subsp. carotovorum (strain PC1)

KEGG orthology group: K00930, acetylglutamate/acetylaminoadipate kinase [EC: 2.7.2.- 2.7.2.8] (inferred from 100% identity to ddd:Dda3937_02060)

MetaCyc: 84% identical to acetylglutamate kinase (Escherichia coli K-12 substr. MG1655)
Acetylglutamate kinase. [EC: 2.7.2.8]

Predicted SEED Role

"Acetylglutamate kinase (EC 2.7.2.8)" in subsystem Arginine Biosynthesis extended (EC 2.7.2.8)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.2.- or 2.7.2.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SLI5 at UniProt or InterPro

Protein Sequence (257 amino acids)

>DDA3937_RS20345 acetylglutamate kinase (Dickeya dadantii 3937)
MNPLIIKLGGVLLDSEEALERLFTALVAYRQQHQRPLVIVHGGGCLVDDLMKKLSLPVVK
KNGLRVTPADQIDIITGALAGSANKTLLAWAIRHGINAVGLSLADGGSTVVTQLNDELGH
VGKAEVGSPALLNTLLNAGYLPVISSIGITAGGELMNVNADQAATALAQTLGADLILLSD
VSGILDGKGQRIAEMTAGKAEELIAQGIITDGMIVKVNAALDAARALGRPVDIASWRHAE
QLPALFNGVSIGTRILA