Protein Info for DDA3937_RS20265 in Dickeya dadantii 3937

Annotation: YeeE/YedE family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 142 transmembrane" amino acids 16 to 42 (27 residues), see Phobius details amino acids 53 to 72 (20 residues), see Phobius details amino acids 78 to 98 (21 residues), see Phobius details amino acids 118 to 140 (23 residues), see Phobius details PF04143: Sulf_transp" amino acids 11 to 132 (122 residues), 30 bits, see alignment E=2e-11

Best Hits

KEGG orthology group: K07112, (no description) (inferred from 100% identity to ddd:Dda3937_02074)

Predicted SEED Role

"Probable transmembrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SLH0 at UniProt or InterPro

Protein Sequence (142 amino acids)

>DDA3937_RS20265 YeeE/YedE family protein (Dickeya dadantii 3937)
MTIDMQAFTPLMSLTGGVVIGVAVVMLALFCGRIAGISGILGGLLGRTWQDKGWRLAFVL
GMFAAPWLYRLAAPLPEIAIATPMPWLVVSGLLVGFGTRYGSGCTSGHGVCGLSRLSLRS
LVATLTFMGAAFVTVWVLGMFR