Protein Info for DDA3937_RS20175 in Dickeya dadantii 3937

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 404 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 46 to 65 (20 residues), see Phobius details amino acids 77 to 96 (20 residues), see Phobius details amino acids 102 to 124 (23 residues), see Phobius details amino acids 136 to 157 (22 residues), see Phobius details amino acids 163 to 184 (22 residues), see Phobius details amino acids 212 to 228 (17 residues), see Phobius details amino acids 249 to 267 (19 residues), see Phobius details amino acids 279 to 296 (18 residues), see Phobius details amino acids 302 to 325 (24 residues), see Phobius details amino acids 336 to 355 (20 residues), see Phobius details amino acids 367 to 388 (22 residues), see Phobius details PF07690: MFS_1" amino acids 17 to 244 (228 residues), 109.5 bits, see alignment E=2.7e-35 amino acids 220 to 388 (169 residues), 42.9 bits, see alignment E=4.9e-15 PF00083: Sugar_tr" amino acids 43 to 199 (157 residues), 93.7 bits, see alignment E=1.9e-30 amino acids 227 to 390 (164 residues), 44.7 bits, see alignment E=1.3e-15

Best Hits

KEGG orthology group: K08178, MFS transporter, SHS family, lactate transporter (inferred from 100% identity to ddd:Dda3937_00247)

Predicted SEED Role

"Putative metabolite transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SKS8 at UniProt or InterPro

Protein Sequence (404 amino acids)

>DDA3937_RS20175 MFS transporter (Dickeya dadantii 3937)
MLGWTSLQRNAAIASFLSWALDAFDFFILVFLLSELAHAFSVSMEQVTLAILLTLAVRPI
GALLLGRLAEKFGRKPILMLNIVLFSVFELLSAAAPNIMVFLLLRVLYGVAMGGIWGVAS
SLAMETIPDRSRGLMSGIFQAGYPFGYLLAAVVYGLLFDQIGWRGMFIIGAVPILLLPFI
YFCVEESPVWLAARVRKESTALLPVLKTHWKLCLYLVVLMASFNFFSHGTQDLYPAFLKI
QHGFDAKTVSIIAISYNIASIIGGIFFGTLSERIGRKKAIIAAALLALPVIPLWAFSHGP
WALGLGAFLMQFMVQGAWGVIPTFLNELVPSNTRAVLPGFVYQLGNLIASVNATLQASIA
EAHNHNYALAMAMVAGVVAIMIAVLAAFSERKWVIKNTMSHAAG