Protein Info for DDA3937_RS20135 in Dickeya dadantii 3937

Annotation: HTH-type transcriptional activator IlvY

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 295 PF00126: HTH_1" amino acids 3 to 62 (60 residues), 75.8 bits, see alignment E=2e-25 PF03466: LysR_substrate" amino acids 87 to 294 (208 residues), 135 bits, see alignment E=2.4e-43

Best Hits

Swiss-Prot: 73% identical to ILVY_SALTY: HTH-type transcriptional activator IlvY (ilvY) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K02521, LysR family transcriptional regulator, positive regulator for ilvC (inferred from 100% identity to ddd:Dda3937_00255)

Predicted SEED Role

"HTH-type transcriptional regulator IlvY" in subsystem Alanine biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SKS0 at UniProt or InterPro

Protein Sequence (295 amino acids)

>DDA3937_RS20135 HTH-type transcriptional activator IlvY (Dickeya dadantii 3937)
MDLRDLKLFLHLVESRHFGRTAKAMHISPSTLSRQIQRLEEDIGQALFLRDNRTVRLTDA
GEHLKTFAQQTLLQYQQLRLILQQRGQSLCGELRLFCSVTAAYSHLPPILDRFRARYPLV
EIKLTTGDAADAVDKVQSNDADLGIAGHPETLPGSVDFMPIGKVPLVLIIPALPCPVQAQ
ALLPHPDWSQIPFILPEHGPVRKRIDVWFRRQHITNPPIYATVSGHEAMVSMVALGCGIA
LIPDVVLENSPEPVRNRVSILEAQAMEPFELGVCVQKKRLNDPLIAAFWETLQEK