Protein Info for DDA3937_RS20050 in Dickeya dadantii 3937

Annotation: UDP-N-acetyl-D-mannosamine dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03721: UDPG_MGDP_dh_N
  • amino acids 5 to 189 (185 residues), 176.4 bits, E=9.7e-56
• TIGR03026: nucleotide sugar dehydrogenase
  • amino acids 5 to 417 (413 residues), 373.2 bits, E=7.2e-116
• PF00984: UDPG_MGDP_dh
  • amino acids 207 to 294 (88 residues), 96.6 bits, E=1.6e-31
• PF03720: UDPG_MGDP_dh_C
  • amino acids 325 to 420 (96 residues), 69.1 bits, E=7.7e-23

Best Hits

Swiss-Prot: 71% identical to WECC_YERPE: UDP-N-acetyl-D-mannosamine dehydrogenase (wecC) from Yersinia pestis

KEGG orthology group: K02472, UDP-N-acetyl-D-mannosaminuronic acid dehydrogenase [EC: 1.1.1.-] (inferred from 100% identity to ddd:Dda3937_00271)

MetaCyc: 70% identical to UDP-N-acetyl-D-mannosamine dehydrogenase (Escherichia coli K-12 substr. MG1655)
UDPMANNACADEHYDROG-RXN [EC: 1.1.1.336]

Predicted SEED Role

"UDP-N-acetyl-D-mannosamine dehydrogenase (EC 1.1.1.-)" (EC 1.1.1.-)

MetaCyc Pathways

• superpathway of enterobacterial common antigen biosynthesis (8/10 steps found)
• UDP-N-acetyl-α-D-mannosaminouronate biosynthesis (1/1 steps found)
• superpathway of UDP-N-acetylglucosamine-derived O-antigen building blocks biosynthesis (8/24 steps found)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Aminosugars metabolism
• Ascorbate and aldarate metabolism
• Benzoate degradation via CoA ligation
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of type II polyketide products
• Biosynthesis of unsaturated fatty acids
• Bisphenol A degradation
• Butanoate metabolism
• C21-Steroid hormone metabolism
• Fructose and mannose metabolism
• Glycine, serine and threonine metabolism
• Insect hormone biosynthesis
• Linoleic acid metabolism
• Nucleotide sugars metabolism
• Polyketide sugar unit biosynthesis
• Retinol metabolism
• Tetrachloroethene degradation

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.-

Use Curated BLAST to search for 1.1.1.- or 1.1.1.336

Sequence Analysis Tools

See E0SKQ4 at UniProt or InterPro

Protein Sequence (421 amino acids)

>DDA3937_RS20050 UDP-N-acetyl-D-mannosamine dehydrogenase (Dickeya dadantii 3937)
MSFNRICVLGLGYIGLPTATLLASRQQSVFGVDVNPHVVESINRGHTHIAEPGLAQAVQT
AVTQGYLQAGSRPVSAQAFLIAVPTPLKADHQPDVSFVEAAALSLSPVLKPGDLVILEST
SPVGTTEQMARWLAQARPDLSFPQQVGEASDIRIAYCPERVLPGRIMEELLSQDRVIGGM
TPRCSARASELYRLFLLDGECAMTDSRTAEMCKLTENSFRDVNIAFANELSLICAEQQID
VWALIRLANRHPRVNILQPGPGVGGHCIAVDPWFIVSQHPQQARLIRTAREVNDAKPNWV
VNQVKIKVADALAQGNTRACDLRIACLGLAFKPDVEDLRESPALAIAEQVAEWHAGATWV
VEPHIRQLPPGLQGKAVQVDIDRALSEADVLILLVDHQQFRAIAPEQVAQRWVVDTKGVW
R