Protein Info for DDA3937_RS19965 in Dickeya dadantii 3937

Annotation: adenylosuccinate lyase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00928: adenylosuccinate lyase
  • amino acids 15 to 443 (429 residues), 365.6 bits, E=1.7e-113
• PF00206: Lyase_1
  • amino acids 17 to 292 (276 residues), 151.3 bits, E=4.4e-48
• PF10397: ADSL_C
  • amino acids 365 to 442 (78 residues), 69.7 bits, E=2.1e-23

Best Hits

Swiss-Prot: 39% identical to PUR8_PYRHO: Adenylosuccinate lyase (purB) from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)

KEGG orthology group: K01756, adenylosuccinate lyase [EC: 4.3.2.2] (inferred from 100% identity to ddd:Dda3937_00284)

Predicted SEED Role

"Adenylosuccinate lyase (EC 4.3.2.2)" in subsystem De Novo Purine Biosynthesis or Purine conversions (EC 4.3.2.2)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (46/46 steps found)
• superpathway of purine nucleotides de novo biosynthesis II (26/26 steps found)
• superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
• superpathway of purine nucleotide salvage (13/14 steps found)
• superpathway of adenosine nucleotides de novo biosynthesis II (7/7 steps found)
• inosine-5'-phosphate biosynthesis I (6/6 steps found)
• inosine-5'-phosphate biosynthesis II (5/5 steps found)
• superpathway of adenosine nucleotides de novo biosynthesis I (5/5 steps found)
• adenosine ribonucleotides de novo biosynthesis (3/3 steps found)
• inosine-5'-phosphate biosynthesis III (5/6 steps found)
• dZTP biosynthesis (3/5 steps found)

KEGG Metabolic Maps

• Alanine and aspartate metabolism
• Biosynthesis of alkaloids derived from histidine and purine
• Purine metabolism

Isozymes

Compare fitness of predicted isozymes for: 4.3.2.2

Use Curated BLAST to search for 4.3.2.2

Sequence Analysis Tools

See E0SKP1 at UniProt or InterPro

Protein Sequence (454 amino acids)

>DDA3937_RS19965 adenylosuccinate lyase (Dickeya dadantii 3937)
MASHLIDFLLIGNNFGTPEMRAVWSEQNRLTRQVDVEIALALAEGDLGVIPQDAASTIAS
HANASALNIEEIAQDAVRMKHSLMPTIAAIQRQCGEAGEYIHYGVTTQDVVDTATVLQLR
QAFDIVVRDTRLVAIELKRLAKKHQHTLMTGRTHGMQALPTTFGFKLAVWLDEFVRHLQR
LNEIRERVLVGNINGAIGTYASFGELGPEIERHTLTRLGLNTPNIGWQSARDRFSEYASV
TVLISGTLGKIGNELYNLMRTEINEIEEPFSEGKIGSTTMPHKRNPAALEGLASLTAPLF
KSAALIHESMKVEHERDAMSWRAEWIALPEINIYLSAQLQNALGILRGMSVNEKQMRANL
DLQNGLLLSEKVMFEIGKLLGKQTAHHLVYECSMAAFEQNREFKALLLEHPVLSQHLTAD
TLDTWLDPANYVGSAPQKVDEVIRYADGTGLLAE