Protein Info for DDA3937_RS19740 in Dickeya dadantii 3937

Annotation: glycogen debranching protein GlgX

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 656 TIGR02100: glycogen debranching enzyme GlgX" amino acids 7 to 654 (648 residues), 962.5 bits, see alignment E=5.1e-294 PF02922: CBM_48" amino acids 11 to 96 (86 residues), 58 bits, see alignment E=1.4e-19 PF00128: Alpha-amylase" amino acids 184 to 267 (84 residues), 29.1 bits, see alignment E=1.1e-10 PF18390: GlgX_C" amino acids 571 to 653 (83 residues), 107.8 bits, see alignment E=3.1e-35

Best Hits

Swiss-Prot: 98% identical to GLGX_DICCH: Glycogen debranching enzyme (glgX) from Dickeya chrysanthemi

KEGG orthology group: K02438, glycogen operon protein GlgX [EC: 3.2.1.-] (inferred from 100% identity to ddd:Dda3937_00331)

MetaCyc: 61% identical to limit dextrin alpha-1,6-glucohydrolase (Escherichia coli K-12 substr. MG1655)
RXN0-5146 [EC: 3.2.1.196]

Predicted SEED Role

"Glycogen debranching enzyme (EC 3.2.1.-)" in subsystem Glycogen metabolism or Trehalose Biosynthesis (EC 3.2.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.2.1.-

Use Curated BLAST to search for 3.2.1.- or 3.2.1.196

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SJV7 at UniProt or InterPro

Protein Sequence (656 amino acids)

>DDA3937_RS19740 glycogen debranching protein GlgX (Dickeya dadantii 3937)
MGELLAGRPRPLGSHFDGEGVNFALFSSGASRVELCIFDGLREQRLPLTARTGDIWHGYL
PDAQPGLCYGYRVDGVFDPSRGQRFNANKLLLDPCARQMDGWVVDDERLHGGYHQPDPSD
SAEVMPRSVVVDEHYDWQDDRLPRTPWSQTVLYEAHVRGLTRRHPGIPAAIRGTYAALAH
PVMLDYLTQLGVTALELMPVQQHADEPRLQSMGLRNYWGYNTLLPFAVDSSLAASDDPLN
EFRDTVRALHQAGIEVILDVVFNHSAELDVDGPTLTLRGIDNASYYWLTESGDYHNWAGC
GNVLRLEHPAVLHWVIECLTFWHEVCHVDGFRFDLATILGRLPDFSSSAPFFTALRNHRS
LRDCKLIAEPWDIGPGGYQLGQFPAPFAEWNDRFRDDMRRFWLHGDLPVGVLARRFAASS
EVFERGSRQPWASVNMLTSHDGFTLRDLVCFNHKHNDANGEQNRDGTNSNFSFNHGTEGL
EADEATQARRRVSQQALLTTLLLSQGTPMLLAGDEFGNSQQGNNNAYCQDNALAWLHWEQ
ADDALLAFTSGLIRLRRSIPALQRGRWWRDDEDDVRWLNAQGEALTPYEWEQGAHQLQIQ
LSERWLLLVNATPQVSDFSLPEGEWRVAPPFSAADHLLDGQTWRGQANAVCVLVKQ