Protein Info for DDA3937_RS19735 in Dickeya dadantii 3937

Annotation: glucose-1-phosphate adenylyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 428 TIGR02091: glucose-1-phosphate adenylyltransferase" amino acids 21 to 398 (378 residues), 507.8 bits, see alignment E=8.6e-157 PF12804: NTP_transf_3" amino acids 22 to 167 (146 residues), 32 bits, see alignment E=1.3e-11 PF00483: NTP_transferase" amino acids 22 to 292 (271 residues), 222.4 bits, see alignment E=7.3e-70

Best Hits

Swiss-Prot: 85% identical to GLGC_PECAS: Glucose-1-phosphate adenylyltransferase (glgC) from Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)

KEGG orthology group: K00975, glucose-1-phosphate adenylyltransferase [EC: 2.7.7.27] (inferred from 100% identity to ddd:Dda3937_00332)

MetaCyc: 79% identical to glucose-1-phosphate adenylyltransferase (Escherichia coli K-12 substr. MG1655)
Glucose-1-phosphate adenylyltransferase. [EC: 2.7.7.27]

Predicted SEED Role

"Glucose-1-phosphate adenylyltransferase (EC 2.7.7.27)" in subsystem Glycogen metabolism (EC 2.7.7.27)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.27

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SJV6 at UniProt or InterPro

Protein Sequence (428 amino acids)

>DDA3937_RS19735 glucose-1-phosphate adenylyltransferase (Dickeya dadantii 3937)
MVSTDKHDPLMLARQLPLKSVALILAGGRGTRLKDLTAYRAKPAVHFGGKYRIIDFALSN
CLNSGIRRIGVITQYQSHTLVQHIQRGWSFLNTEMNEFVDLLPAQQRHDENDHWYRGTAD
AVCHNLDIIRRYRAEYVVILAGDHIYKMDYSRMLLDHVENGAECSVACIPVPIKEAHAFG
VMSVDKDNRIISFDEKPAKPTPMPDNPDMALASMGIYVFNADYLYRRLEEDVCTSDSSHD
FGKDLIPKIVAQGHAWAHPFTLSCVTSSDNAPPYWRDVGTLEAYWRANLDLASVMPELDM
YDHNWPIRSAMAALPPAKFVQDRSGSHGLTMNSLVSGGSIVSGSVVTHSVLFPRVRINSF
CSIDSSVLLPDVNVGRSCRLHRCIVDRACEIPEGMVIGENAEDDSRRFYRSEEGIVLVTR
AMLAKLKP