Protein Info for DDA3937_RS19635 in Dickeya dadantii 3937

Annotation: RNA-binding transcriptional accessory protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 781 PF09371: Tex_N" amino acids 9 to 192 (184 residues), 250.6 bits, see alignment E=2.6e-78 PF16921: Tex_YqgF" amino acids 327 to 450 (124 residues), 169.3 bits, see alignment E=1.5e-53 PF14635: HHH_7" amino acids 463 to 555 (93 residues), 38.3 bits, see alignment E=4.3e-13 PF12836: HHH_3" amino acids 490 to 554 (65 residues), 98.9 bits, see alignment E=4.6e-32 PF17674: HHH_9" amino acids 560 to 629 (70 residues), 85.6 bits, see alignment E=1e-27 PF00575: S1" amino acids 650 to 719 (70 residues), 86.1 bits, see alignment E=5.2e-28

Best Hits

Swiss-Prot: 85% identical to YHGF_ECOLI: Protein YhgF (yhgF) from Escherichia coli (strain K12)

KEGG orthology group: K06959, uncharacterized protein (inferred from 100% identity to ddd:Dda3937_04417)

Predicted SEED Role

"Transcription accessory protein (S1 RNA-binding domain)" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SJT6 at UniProt or InterPro

Protein Sequence (781 amino acids)

>DDA3937_RS19635 RNA-binding transcriptional accessory protein (Dickeya dadantii 3937)
MTNALSQIIASELQARNEQVSAAIQLLDEGNTVPFIARYRKEVTGGLDDTQLRQLETRLS
YLRELEERRQTILKSIEEQGKLTDALATSINTTLSKTELEDLYLPYKPKRRTRGQIAIEA
GLEPLADSLWNDPSQTPELVAEAYINADNGVADVKAALDGARYILMERFAEDAALLAKVR
DYLWKNAHLVSRVVEGKEEDGAKFRDYFDHHEPLSQVPSHRALAMFRGRNEGVLQLSLNA
DPQFDEPPKESHCEHIIIEHLGLRLGNAPADGWRRAVVNWTWRIKVLLHLETELMGSVRE
KAEDEAINVFARNLHDLLMAAPAGMRATMGLDPGLRTGVKVAVVDATGKLVATDTIYPHT
GQTAKAATVVAALCIKHQVELVAIGNGTASRETERFFLDTQKQFPDVKAQKVIVSEAGAS
VYSASELAALEFPDLDVSLRGAVSIARRLQDPLSELVKIDPKSIGVGQYQHDVSQTQLAK
KLDAVVEDCVNGVGVDLNTASVPLLTRVAGLTRLMAQNIVSWRDENGRFNNRDQLLKVSR
LGPKAFEQCAGFLRINHGDNPLDASTVHPEAYPVVERILAATEQKLQDLMGNASALRSLK
PASFTDDRFGVPTVTDIIKELEKPGRDPRPEFKTASFADGVETLNDLLPGMILEGAVTNV
TNFGAFVDIGVHQDGLVHISSLSDRFVEDPHQVVKAGDIVKVKVLEVDLQRKRIALTMRL
DEQPGEGNSRRGSGGRERDNGNNNASRPSQAGNKARPRQSNTPASGNSAMSDALAAAFKK
R