Protein Info for DDA3937_RS19625 in Dickeya dadantii 3937

Annotation: transcription elongation factor GreB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 166 TIGR01461: transcription elongation factor GreB" amino acids 2 to 155 (154 residues), 254.6 bits, see alignment E=1.4e-80 PF03449: GreA_GreB_N" amino acids 5 to 74 (70 residues), 85.5 bits, see alignment E=2.3e-28 PF01272: GreA_GreB" amino acids 81 to 155 (75 residues), 80.3 bits, see alignment E=8.2e-27

Best Hits

Swiss-Prot: 75% identical to GREB_ECOLI: Transcription elongation factor GreB (greB) from Escherichia coli (strain K12)

KEGG orthology group: K04760, transcription elongation factor GreB (inferred from 100% identity to ddd:Dda3937_00353)

Predicted SEED Role

"Transcription elongation factor GreB" in subsystem Transcription factors bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SJT4 at UniProt or InterPro

Protein Sequence (166 amino acids)

>DDA3937_RS19625 transcription elongation factor GreB (Dickeya dadantii 3937)
MKTDLITREGYEALHQELNYLWKERRPEITEKVAWAASLGDRSENADYLYNKRLLREIDR
RVRYLRKRLQVVRVVDYSPQQDGKVFFGAWVEVENEDGDVKRFRIVGPDEIYGRKDYISI
DAPMARALLKKAVDEEAVVNTPTGPKVWYVNKIDYRNPIGYRNPID