Protein Info for DDA3937_RS19615 in Dickeya dadantii 3937

Annotation: two-component system sensor histidine kinase EnvZ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 467 transmembrane" amino acids 12 to 39 (28 residues), see Phobius details amino acids 160 to 179 (20 residues), see Phobius details PF00672: HAMP" amino acids 177 to 225 (49 residues), 32.6 bits, see alignment 1.2e-11 PF00512: HisKA" amino acids 234 to 290 (57 residues), 45.8 bits, see alignment 7.8e-16 PF02518: HATPase_c" amino acids 335 to 438 (104 residues), 89.2 bits, see alignment E=3.7e-29

Best Hits

Swiss-Prot: 86% identical to ENVZ_SALTY: Osmolarity sensor protein EnvZ (envZ) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K07638, two-component system, OmpR family, osmolarity sensor histidine kinase EnvZ [EC: 2.7.13.3] (inferred from 100% identity to ddd:Dda3937_00355)

MetaCyc: 84% identical to sensor histidine kinase EnvZ (Escherichia coli K-12 substr. MG1655)
Histidine kinase. [EC: 2.7.13.3]

Predicted SEED Role

"Osmolarity sensory histidine kinase EnvZ"

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SJT2 at UniProt or InterPro

Protein Sequence (467 amino acids)

>DDA3937_RS19615 two-component system sensor histidine kinase EnvZ (Dickeya dadantii 3937)
MIRWRFSPRSAFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD
KLQLEDGSTLDVPPAFRREIYRELGISLYTNAAAEESGLRWAQHYKFLSQQMAQQLGGPT
EVRVEVSKNTPVVWLKTWLSPDIWVRVPLTEIHQGDFSPLFRYTLAIMLLVIGGAWLFIR
VQNRPLVELEHAAIQVGKGIIPPPLREYGASEVRSVTRAFNQMASGVKLLADDRTLLMAG
VSHDLRTPLTRIRLATEMMGQEDEYLAESINKDIEECNAIIEQFIDYLRTGQEMQMEVAD
LNAILGEVVASESGYEREIESELAWGELPMKVSPLSIKRAVANLVVNAARYGNGWIRVSS
GRELQRAWFQVEDDGPGIDPSQLTHLFQPFVRGDSARSTSGTGLGLAIVQRIIDAHNGSL
DVGASERGGLRVRAYLPLAFPNQSGATPARDSNRRTSVPANSRKREK