Protein Info for DDA3937_RS19120 in Dickeya dadantii 3937

Annotation: DNA-protecting protein DprA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 377 TIGR00732: DNA protecting protein DprA" amino acids 66 to 283 (218 residues), 273.4 bits, see alignment E=5.3e-86 PF02481: DNA_processg_A" amino acids 67 to 274 (208 residues), 257.5 bits, see alignment E=7.2e-81 PF17782: DprA_WH" amino acids 308 to 360 (53 residues), 41.1 bits, see alignment 1.5e-14

Best Hits

KEGG orthology group: K04096, DNA processing protein (inferred from 100% identity to ddd:Dda3937_01524)

Predicted SEED Role

"Rossmann fold nucleotide-binding protein Smf possibly involved in DNA uptake" in subsystem Conserved gene cluster associated with Met-tRNA formyltransferase

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SIT7 at UniProt or InterPro

Protein Sequence (377 amino acids)

>DDA3937_RS19120 DNA-protecting protein DprA (Dickeya dadantii 3937)
MTDMEIWLRLASVKGLGAKRCAALFGQLQAENSYPAEYLKSLGLTENQTEQFLSLSVLDI
QNTSHWLEKPEHHLVTFNSADYPPLLSNIVSPPLCLYVAGDVGVLSSPQVAVIGSRNNSA
YGEQWGHVFSQQLSLNHLTITSGLAVGIDGIAHQAALQAGGKTIAVLGSGLNQLYPRRHL
TLADAIVQQGGALVSEFPLNTRPLPVNFPRRNRIISGLSLGVLVVEASMRSGSLVTARYA
LEQNREVFALPGPIGNPMTEGNHWLIQQGASLVTQPQDIFEQLHNGLRWFADIPGEGIPE
IICAAEGELELPFADVLATVGDEVTPVDVVAERAGQPVPEVVSKLLDLELAGWIAAVPGG
YVRIRRAGHVRRTHVLV