Protein Info for DDA3937_RS18975 in Dickeya dadantii 3937

Annotation: fumarate reductase subunit FrdC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 76% identical to FRDC_YERE8: Fumarate reductase subunit C (frdC) from Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)

KEGG orthology group: K00246, fumarate reductase subunit C (inferred from 97% identity to ddc:Dd586_3679)

MetaCyc: 71% identical to fumarate reductase membrane protein FrdC (Escherichia coli K-12 substr. MG1655)
Succinate dehydrogenase (ubiquinone). [EC: 1.3.5.1]

Predicted SEED Role

"Fumarate reductase subunit C" in subsystem Succinate dehydrogenase

MetaCyc Pathways

superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (25/26 steps found)
mixed acid fermentation (16/16 steps found)
superpathway of glyoxylate bypass and TCA (11/12 steps found)
superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (18/22 steps found)
TCA cycle I (prokaryotic) (9/10 steps found)
partial TCA cycle (obligate autotrophs) (7/8 steps found)
superpathway of glyoxylate cycle and fatty acid degradation (11/14 steps found)
aerobic respiration III (alternative oxidase pathway) (3/3 steps found)
TCA cycle III (animals) (8/10 steps found)
TCA cycle VIII (Chlamydia) (5/6 steps found)
NADH to fumarate electron transfer (2/2 steps found)
glycerol-3-phosphate to fumarate electron transfer (2/2 steps found)
succinate to cytochrome bd oxidase electron transfer (2/2 steps found)
TCA cycle II (plants and fungi) (7/9 steps found)
TCA cycle V (2-oxoglutarate synthase) (7/9 steps found)
TCA cycle VI (Helicobacter) (7/9 steps found)
reductive TCA cycle I (8/11 steps found)
incomplete reductive TCA cycle (5/7 steps found)
hydrogen to fumarate electron transfer (1/2 steps found)
succinate to cytochrome aa₃ oxidase electron transfer (1/2 steps found)
succinate to cytochrome bo oxidase electron transfer (1/2 steps found)
TCA cycle IV (2-oxoglutarate decarboxylase) (6/9 steps found)
TCA cycle VII (acetate-producers) (6/9 steps found)
reductive TCA cycle II (8/12 steps found)
aerobic respiration I (cytochrome c) (2/4 steps found)
aerobic respiration II (cytochrome c) (yeast) (2/4 steps found)
(S)-lactate fermentation to propanoate, acetate and hydrogen (8/13 steps found)
pyruvate fermentation to propanoate I (3/7 steps found)
anaerobic energy metabolism (invertebrates, mitochondrial) (5/10 steps found)
superpathway of anaerobic energy metabolism (invertebrates) (10/17 steps found)
L-glutamate degradation VIII (to propanoate) (3/11 steps found)
methylaspartate cycle (8/19 steps found)
Methanobacterium thermoautotrophicum biosynthetic metabolism (22/56 steps found)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.3.5.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SI29 at UniProt or InterPro

Protein Sequence (131 amino acids)

>DDA3937_RS18975 fumarate reductase subunit FrdC (Dickeya dadantii 3937)
MITKRKAYVRGMTPTWWQKLGFYRFYMLREGTAVPAVWFSIVLLHGVFSLKAGPEGWSQF
VGFLQNPLVLLLNIIALLAAVLHTKTWFDLAPKAAIIIVKDEKMGPEPIVKGLWAAAVVI
TLAVLAIALLF