Protein Info for DDA3937_RS18690 in Dickeya dadantii 3937

Annotation: glycosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 375 PF13439: Glyco_transf_4" amino acids 16 to 174 (159 residues), 60.1 bits, see alignment E=5.9e-20 PF00534: Glycos_transf_1" amino acids 188 to 348 (161 residues), 110.1 bits, see alignment E=1.8e-35 PF13692: Glyco_trans_1_4" amino acids 196 to 332 (137 residues), 80.4 bits, see alignment E=3.3e-26 PF13524: Glyco_trans_1_2" amino acids 275 to 362 (88 residues), 29.9 bits, see alignment E=1.1e-10

Best Hits

KEGG orthology group: K12995, rhamnosyltransferase [EC: 2.4.1.-] (inferred from 100% identity to ddd:Dda3937_00449)

Predicted SEED Role

"Glycosyltransferase (EC 2.4.1.-)" (EC 2.4.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.4.1.-

Use Curated BLAST to search for 2.4.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SHX0 at UniProt or InterPro

Protein Sequence (375 amino acids)

>DDA3937_RS18690 glycosyltransferase (Dickeya dadantii 3937)
MINVLHFYKTYYPYTYGGIEQVIFQLCEGAAHHGVNSTVEYIAPNKDSDIEQFHHHNVTC
DHKLFEISSTPFSLSSIRKFKKLAESADIIHYHFPYPFADMLHFICKIKKPTVVSYHSDI
LKQKYLLKLYKPLMYNFLDSVTSIVATSPNYLATSETLQKFSHKTSVIPIGLDARSHQVI
DNDNKLKWQKILPERFLLFIGNLRYYKGLGTLLDAIENSPEIKIVIIGSGPQEKQLKEQV
SRKNIENVYFLGALPDNDKNTLLALCSGIVFPSQLRTEAFGITLLEGAMYGKPLISCEIG
TGTSFINIDRQTGIVVPPSDPAKLREAMEYLWVNPEKAQEMGMNAQKRFHELFTAEKMVN
DYVALYKKLLHREHA