Protein Info for DDA3937_RS18465 in Dickeya dadantii 3937

Annotation: Tar ligand binding domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 568 transmembrane" amino acids 16 to 42 (27 residues), see Phobius details amino acids 202 to 222 (21 residues), see Phobius details PF02203: TarH" amino acids 11 to 177 (167 residues), 83.9 bits, see alignment E=2e-27 PF00672: HAMP" amino acids 222 to 272 (51 residues), 46.3 bits, see alignment 6.3e-16 PF00015: MCPsignal" amino acids 335 to 490 (156 residues), 192.4 bits, see alignment E=8.9e-61

Best Hits

Swiss-Prot: 57% identical to MCP3_ECOLI: Methyl-accepting chemotaxis protein III (trg) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to ddd:Dda3937_00404)

Predicted SEED Role

"Methyl-accepting chemotaxis protein III (ribose and galactose chemoreceptor protein)" in subsystem Bacterial Chemotaxis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SH41 at UniProt or InterPro

Protein Sequence (568 amino acids)

>DDA3937_RS18465 Tar ligand binding domain-containing protein (Dickeya dadantii 3937)
MAEQKGNISSINNIRLVTLFITLLTIILILFALSIGTASYFLKQSNASLGRANLVSEIRA
GVSSSMDNFRVSRQLLVQAVASSRIGDKDSYSQAFNEGMERIKSSQKRFDDYMARTDKSD
EEKALDAELTANYTAYRDKVMVPMVEFVRNGEFESTIELETTLARQLDTNYAMQVRKEVK
YLTEHANSINALASDNARLGNILMGASFILSILLAALTYLVIRRAILVPVNVLITRIQKI
AQGDLTQPAENMGRNEIGILGQNLQHMQESLTNTVTVVREGADSIYQGASEISAGNVDLS
SRTEQQAAALEQTAASMEELTSTVKQNSDNANHASQLARNASGKAEQGGNIVQDVVKTMG
DISSSSRKISEITSVINSIAFQTNILALNAAVEAARAGEQGRGFAVVAGEVRSLAQRSAQ
AAKEIESLIGESGRLVDTGSELVAKAGSTMEEIVKAVVSVTDIMGEIASASDEQSRGIGQ
VNQAVLEMEGTTQQNAALVQEASAAAVSLESQAERLTQAVAVFKLSHRRDSEPVRASLPS
RPTAQPVPAVAAIGAGRVSRNDQNWETF